BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0157 (775 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 23 3.2 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 23 4.2 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 23.0 bits (47), Expect = 3.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 664 KR*KSDXLTSQDEXALRQHK*LDHQNRFQSR 756 +R SD +TSQ + +Q + D Q + QSR Sbjct: 79 QREHSDRVTSQQQQQQQQQQQQDQQQQQQSR 109 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 22.6 bits (46), Expect = 4.2 Identities = 13/57 (22%), Positives = 24/57 (42%) Frame = +3 Query: 327 YQSYTQANNVCQTFRSFKQNVFIVKIVKFWLEHKTLVQKLNTNII*NYLKYLPQTAW 497 + + T NN + + K + +W + +++ L T+II LPQ W Sbjct: 238 FDNATIVNNGPEAAKMAKAFTYTYNYSMYWGQGHAILKGLKTSIILMNGTTLPQIMW 294 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,819 Number of Sequences: 438 Number of extensions: 3806 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24275400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -