BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0157 (775 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g29260.1 68416.m03672 short-chain dehydrogenase/reductase (SD... 29 4.5 At1g78620.2 68414.m09163 integral membrane family protein contai... 29 4.5 At1g78620.1 68414.m09162 integral membrane family protein contai... 29 4.5 >At3g29260.1 68416.m03672 short-chain dehydrogenase/reductase (SDR) family protein similar to 3-beta-hydroxysteroiddehydrogenase GI:15983819 from [Digitalis lanata] Length = 259 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +2 Query: 200 LKARHVGHQHKFSKSESTSNIYLTNFGTDIKFPIIKATSD 319 LKARHV F S+ + I N G D + ++K TS+ Sbjct: 220 LKARHVADAALFLASDDSVYISGQNLGVDGGYSVVKLTSN 259 >At1g78620.2 68414.m09163 integral membrane family protein contains Pfam domain PF01940: Integral membrane protein Length = 342 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 523 CVC*LLF*YQAV*GRYLR*FYIIFVFSFCTKV 428 CVC L YQ + + F + FV SFCTKV Sbjct: 188 CVCAFLSIYQVGGAAFSQLFRLGFVSSFCTKV 219 >At1g78620.1 68414.m09162 integral membrane family protein contains Pfam domain PF01940: Integral membrane protein Length = 333 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 Query: 523 CVC*LLF*YQAV*GRYLR*FYIIFVFSFCTKV 428 CVC L YQ + + F + FV SFCTKV Sbjct: 179 CVCAFLSIYQVGGAAFSQLFRLGFVSSFCTKV 210 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,715,361 Number of Sequences: 28952 Number of extensions: 251177 Number of successful extensions: 400 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 400 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -