BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0156 (774 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 23 3.6 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 23 3.6 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 8.3 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.6 bits (46), Expect = 3.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 181 LDKLKAERERGITIDIALWKFETSKYYVTII 273 L KLK + G + +A KF K+YV I+ Sbjct: 78 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 108 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.6 bits (46), Expect = 3.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 181 LDKLKAERERGITIDIALWKFETSKYYVTII 273 L KLK + G + +A KF K+YV I+ Sbjct: 4 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 34 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/27 (33%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 553 NPSAVAFVPISGWH-GDNMLEPSTKMP 630 NP+ + I GW+ G+ +L P P Sbjct: 93 NPNLKTIISIGGWNAGNAILAPIAASP 119 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.135 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,392 Number of Sequences: 336 Number of extensions: 3629 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -