Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0150
         (775 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY695258-1|AAW21975.1|  232|Tribolium castaneum muscle segment h...    25   0.89 
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    22   6.3  

>AY695258-1|AAW21975.1|  232|Tribolium castaneum muscle segment
           homeodomain protein protein.
          Length = 232

 Score = 24.6 bits (51), Expect = 0.89
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -1

Query: 718 PPAFDLFPGDAP 683
           PP+F +FPG AP
Sbjct: 190 PPSFGIFPGGAP 201


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
            adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 21.8 bits (44), Expect = 6.3
 Identities = 11/37 (29%), Positives = 15/37 (40%)
 Frame = +3

Query: 24   VPGNGYAXKLFEVVDEHKLXIFYXKRMGAEXXADXLG 134
            VPG        E  D+H L +++      E   D LG
Sbjct: 994  VPGGPPTSIRVETNDQHSLVVYWKPPAREEWNGDILG 1030


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 118,337
Number of Sequences: 336
Number of extensions: 1618
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20857569
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)