BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brP-0150
(775 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 25 0.89
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 6.3
>AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment
homeodomain protein protein.
Length = 232
Score = 24.6 bits (51), Expect = 0.89
Identities = 8/12 (66%), Positives = 10/12 (83%)
Frame = -1
Query: 718 PPAFDLFPGDAP 683
PP+F +FPG AP
Sbjct: 190 PPSFGIFPGGAP 201
>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
adhesion molecule splicevariant 3.12.3.1 protein.
Length = 1639
Score = 21.8 bits (44), Expect = 6.3
Identities = 11/37 (29%), Positives = 15/37 (40%)
Frame = +3
Query: 24 VPGNGYAXKLFEVVDEHKLXIFYXKRMGAEXXADXLG 134
VPG E D+H L +++ E D LG
Sbjct: 994 VPGGPPTSIRVETNDQHSLVVYWKPPAREEWNGDILG 1030
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 118,337
Number of Sequences: 336
Number of extensions: 1618
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 20857569
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -