BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0149 (775 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0944 - 29557360-29557485,29557570-29557698,29557875-295579... 29 5.4 05_01_0347 - 2717275-2717613,2717994-2718077,2718185-2718247,271... 28 7.2 02_01_0112 - 839048-839552,839638-839720,839828-839982,840078-84... 28 9.5 01_05_0274 - 20293963-20294065,20294501-20294560,20295006-202950... 28 9.5 >04_04_0944 - 29557360-29557485,29557570-29557698,29557875-29557917, 29558321-29558400,29558493-29558804 Length = 229 Score = 28.7 bits (61), Expect = 5.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 426 WVISLLRTSRRGQLFYLLALLEPDLPFP 509 W+ + L + +R LFY A L P L FP Sbjct: 106 WIFAWLDSGKRRYLFYAAAYLAPYLSFP 133 >05_01_0347 - 2717275-2717613,2717994-2718077,2718185-2718247, 2718350-2718488,2719118-2719219,2719324-2719424, 2719915-2719981,2720074-2720120,2720246-2720440, 2720523-2720569,2721242-2721339,2722219-2722337, 2722438-2722611 Length = 524 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 461 TVILFVGAIGTGSAFSLXSTTIGALF 538 T+ILF GA+GT +F + S IGA+F Sbjct: 112 TIILF-GAVGTLISFVIISLAIGAIF 136 >02_01_0112 - 839048-839552,839638-839720,839828-839982,840078-840557, 840855-841097,841189-841403,841489-841756,842477-842525 Length = 665 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -1 Query: 664 LLKFLTTNVQTHLDPYDIDQ---DY*VLLISLKYTAMLSK 554 + + L TN THL D DQ +Y + LI KY+ +SK Sbjct: 245 VFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKYSKDISK 284 >01_05_0274 - 20293963-20294065,20294501-20294560,20295006-20295052, 20296065-20296155,20296276-20296427,20296891-20297049, 20297132-20297381,20298255-20298317,20298394-20298566 Length = 365 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -3 Query: 248 ISVIGW-LWSLQSGSTNKTKPYANLNTVVTIQFDSPQCF 135 +S W LW++ G + P LNT + I F + QCF Sbjct: 150 LSTTCWALWTVLQGPMLEVYPSKLLNTTIQIVFATIQCF 188 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,346,962 Number of Sequences: 37544 Number of extensions: 321773 Number of successful extensions: 643 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2068401984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -