BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0146 (809 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0147 + 21195222-21195377,21195471-21195522,21196842-212043... 30 2.5 03_02_0884 + 12160453-12160518,12160598-12160696,12163223-121633... 29 4.4 12_01_0588 + 4795620-4796093,4796124-4797476,4797575-4797827,479... 28 7.6 04_04_1683 + 35345506-35345581,35346171-35346343,35346706-353467... 28 7.6 03_02_0475 + 8760948-8760987,8761043-8761181,8761268-8761358,876... 28 7.6 >09_06_0147 + 21195222-21195377,21195471-21195522,21196842-21204362, 21204453-21205031,21205176-21205484,21205638-21205718, 21205971-21206279,21207430-21207816,21207964-21208767, 21208856-21209218,21209437-21209667,21209934-21210278, 21210494-21210712,21210759-21210815,21210978-21211322, 21211538-21211756,21211803-21211859,21212022-21212366, 21212584-21212814,21213100-21213458 Length = 4322 Score = 29.9 bits (64), Expect = 2.5 Identities = 19/54 (35%), Positives = 25/54 (46%) Frame = +3 Query: 333 SVARSQTW*SATNGANTGAQSESTTNSATTEISYANTHTGITEWAPSINRSLTR 494 SV SQ + NG+ TGA S T S + E S I++ P N S T+ Sbjct: 4242 SVTASQVLGRSENGSGTGALSGETVPSNSQENSEGTPSEEISKQQPQTNMSSTK 4295 >03_02_0884 + 12160453-12160518,12160598-12160696,12163223-12163357, 12163841-12163891,12164070-12164693,12164779-12164952, 12165047-12165272,12165368-12165459,12165551-12165649, 12165743-12165791,12165878-12165931,12166235-12166290, 12166367-12166438,12166520-12166615,12167069-12167418, 12167508-12167679,12167777-12167875,12167959-12168090, 12168185-12168288,12168369-12168401,12168744-12168930, 12169016-12169024 Length = 992 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 Query: 100 YLRHWIVYFLHIKYKHKTSLHSSHSMIFTY 11 Y RHW V+ +H+K + L S H F Y Sbjct: 845 YKRHWFVFIVHLKDEMFVFLDSLHEEGFEY 874 >12_01_0588 + 4795620-4796093,4796124-4797476,4797575-4797827, 4797989-4798108,4798542-4798564,4798734-4798841 Length = 776 Score = 28.3 bits (60), Expect = 7.6 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 287 AAPVCSPLLNSSPCL*RC 340 A P+C P+ +SSPC RC Sbjct: 679 AKPMCCPVQDSSPCFGRC 696 >04_04_1683 + 35345506-35345581,35346171-35346343,35346706-35346739, 35346919-35347055,35347356-35347422,35347645-35347744, 35348375-35348538,35349023-35349069,35349177-35349224, 35349463-35349976,35350190-35350278,35350472-35350549, 35350972-35351019 Length = 524 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +1 Query: 508 QPSQTRT-HDSEHNQPTMHQVFITPNQQIIINGPDKA 615 +P QT + H+ EH QP MH+ QI + GP++A Sbjct: 394 RPQQTSSGHEGEHGQPGMHR---DAGIQINLAGPEQA 427 >03_02_0475 + 8760948-8760987,8761043-8761181,8761268-8761358, 8761436-8761499,8762837-8762942,8763018-8763072, 8764377-8764430,8765223-8765312,8765462-8765518 Length = 231 Score = 28.3 bits (60), Expect = 7.6 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 227 VWWGVSLWARVACSMSGRWTAA 292 VW G+S ++RVA S+ G W+ A Sbjct: 46 VWPGLSCFSRVATSLRGGWSGA 67 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,218,389 Number of Sequences: 37544 Number of extensions: 413947 Number of successful extensions: 1137 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1088 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1137 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2209429392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -