BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0145 (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) 31 1.3 SB_4976| Best HMM Match : SET (HMM E-Value=0.05) 29 5.1 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_27777| Best HMM Match : WSC (HMM E-Value=0.44) 28 8.9 >SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) Length = 750 Score = 30.7 bits (66), Expect = 1.3 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +2 Query: 173 KIXLPSAENXATENTQXSLFDGIE--KFDSSQLKHTETPRRTRFRSK 307 K LP A+N E L D E KFD+S+LKH ET + +K Sbjct: 507 KNPLPDAQNIRAEMMPEVLPDRSEVAKFDTSKLKHVETKEKVVMPTK 553 Score = 29.5 bits (63), Expect = 2.9 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = +1 Query: 283 EKNPLPVXDAIDAENEKNRIPERXRVTXIPLS*SXRXRA-IKNPXPTXDXIEQEK 444 EKN LP + I E + + P+R V S KN PT D I EK Sbjct: 429 EKNTLPSDETIKQELQPDEFPDRAEVKSFEKSKLQHVETKEKNTLPTKDTIADEK 483 Score = 29.1 bits (62), Expect = 3.8 Identities = 18/57 (31%), Positives = 24/57 (42%) Frame = +2 Query: 110 PEESARRLXDHAVXXTSTPMMKIXLPSAENXATENTQXSLFDGIEKFDSSQLKHTET 280 P+ S DH T K +PS E+ E ++ FD S+LKH ET Sbjct: 602 PDRSEVASFDHTKLKHVTTQEKSIMPSQEDIKEEAVDSRA--EVKSFDHSKLKHVET 656 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 173 KIXLPSAENXATENTQXSLFDGIEKFDSSQLKHTET 280 K LP+ + A E + + F G+E F ++LKH ET Sbjct: 470 KNTLPTKDTIADEK-RTAPFSGVEVFQKNKLKHVET 504 >SB_4976| Best HMM Match : SET (HMM E-Value=0.05) Length = 296 Score = 28.7 bits (61), Expect = 5.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +2 Query: 2 HGILYPLPHQKYIDSXWPAP*VTLPP*XTLPKVATVPE 115 HG L +PH K I S +P V P L K +T+PE Sbjct: 87 HGPLEWIPHSKAISSAHYSPCVASLPDGLLMKESTIPE 124 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/49 (26%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +1 Query: 235 RYREV*FEPAEAHRDSEKNPLPVXDAI-DAENEKNRIPERXRVTXIPLS 378 ++ E+ EP++ HR+ + D++NE +PE+ V IP++ Sbjct: 445 KFEELAIEPSKKHRNEASGSKTTRNVSEDSDNEFEDVPEKEGVECIPVN 493 >SB_27777| Best HMM Match : WSC (HMM E-Value=0.44) Length = 216 Score = 27.9 bits (59), Expect = 8.9 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +1 Query: 244 EV*FEPAEAHRDSEKNPLPVXDAIDAENEKNRIPERXRVTXIP 372 EV FEP +RDS + P P+ + + N++N I T +P Sbjct: 10 EVAFEPIGCYRDSGRKPQPLTEQL--SNDRNAIDWNKWNTLMP 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,033,912 Number of Sequences: 59808 Number of extensions: 255472 Number of successful extensions: 565 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -