BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0145 (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 25 2.4 Y09953-1|CAA71084.1| 91|Anopheles gambiae histone H4 protein. 23 9.6 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 25.0 bits (52), Expect = 2.4 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -1 Query: 141 WS*SLRADSSGTVATLGRVXQGGSVTHGAGHXESIYF 31 W +SS V+ +GR+ GS HG IY+ Sbjct: 680 WVCIAHRESSYNVSAIGRLNADGSEDHGLFQISDIYW 716 >Y09953-1|CAA71084.1| 91|Anopheles gambiae histone H4 protein. Length = 91 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 658 GVRRXSSLVYE*XPGLLXVXI 596 GV+R S L+YE G+L V + Sbjct: 43 GVKRISGLIYEERRGVLKVFL 63 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 524,574 Number of Sequences: 2352 Number of extensions: 7860 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -