BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0143 (773 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 6.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 8.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 8.3 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 8.3 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/47 (21%), Positives = 21/47 (44%) Frame = +3 Query: 468 YAQDLEKTGSVIHMPVPSSYNDVGEDASLRDHVSLVWYDRXFHVPPW 608 Y + +TG V + +S+ D +D +L ++ + +P W Sbjct: 493 YVHRIGRTGRVGNKGKATSFFDEDQDRNLASDLAKILSQAKQEIPEW 539 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = -1 Query: 569 AYMVPKRGVFAHVII*RGHRHVYHRACLFKILRIPAIS 456 AY++P+ G + + R CL+K+ ++P++S Sbjct: 128 AYLIPEVGTWIRAV----------RKCLYKLWKMPSLS 155 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = -1 Query: 569 AYMVPKRGVFAHVII*RGHRHVYHRACLFKILRIPAIS 456 AY++P+ G + + R CL+K+ ++P++S Sbjct: 128 AYLIPEVGTWIRAV----------RKCLYKLWKMPSLS 155 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.4 bits (43), Expect = 8.3 Identities = 16/53 (30%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +3 Query: 330 YKRKLPSNGGALYPRATETRDL-----RTLXGIWSFRPSPADPEFGYRNGWYA 473 Y+ S G + T T D R G + FRP + GY G YA Sbjct: 41 YQHHFNSPAGNAHTGPTGTHDAGFPSPRGALGAYPFRPMHQNSYTGYHLGSYA 93 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,235 Number of Sequences: 336 Number of extensions: 3541 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -