BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0143 (773 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 27 0.64 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 23 7.9 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 27.1 bits (57), Expect = 0.64 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -2 Query: 640 LSQTRCFAVCHHGGTWNXLSYHTKLTWSRREASSPTSLYEEGTGMCITEP--VFSRSCAY 467 L QT ++C G +N Y K + +R S E+G G C T+P ++C Y Sbjct: 131 LEQTVLQSICSIDGDFNDTQYEGKWSAVKRMLLSVRLPPEDGAG-CATQPCSALLKACRY 189 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 305 RRQRHHCYRHGHYA 264 RRQ + CY +GH A Sbjct: 211 RRQCYRCYEYGHTA 224 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,485 Number of Sequences: 2352 Number of extensions: 14803 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -