BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0139 (722 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC607.10 |spo3||sporulation protein Spo3|Schizosaccharomyces p... 26 4.7 SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosacchar... 25 8.3 >SPAC607.10 |spo3||sporulation protein Spo3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1028 Score = 26.2 bits (55), Expect = 4.7 Identities = 10/43 (23%), Positives = 21/43 (48%) Frame = +2 Query: 341 NEYANHIXDAQNXTNQLIDFVCYKDGDRIALFIAEXGPDCFQQ 469 NE+ +++ N +D++C D + +++ DCF Q Sbjct: 269 NEFTGFNSNSEWIPNDTVDYICNSDASSVVSNLSDF-EDCFDQ 310 >SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 25.4 bits (53), Expect = 8.3 Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 2/62 (3%) Frame = +2 Query: 116 TKNNAEDKVPEVEAXLRTFGNCLKGLVDLNVLKTEIEEAKPN--GALDEVFKKYCDKSAQ 289 T+N+ K+ ++ +++F CL +LN LK+ + + + A +V +Y KS Sbjct: 40 TQNDGSKKLSSIDGSIKSFAACLH---ELNRLKSRVGDRIRDYASASKQVQNEYHQKSNH 96 Query: 290 LK 295 L+ Sbjct: 97 LR 98 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,516,326 Number of Sequences: 5004 Number of extensions: 42503 Number of successful extensions: 90 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -