BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0138 (809 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g01950.1 68417.m00260 phospholipid/glycerol acyltransferase f... 32 0.39 >At4g01950.1 68417.m00260 phospholipid/glycerol acyltransferase family protein contains Pfam profile PF01553: Acyltransferase Length = 520 Score = 32.3 bits (70), Expect = 0.39 Identities = 18/84 (21%), Positives = 38/84 (45%), Gaps = 2/84 (2%) Frame = +2 Query: 338 YAFGTIGTLVVGMRIIVSFFIPHKLAML*IFYNGCLCDVLMNYIMHLALLALW*WGCVLL 517 + +G R+ VS IP+ L++ + ++GC V +Y+ GC+ + Sbjct: 272 FMWGPFAAAAAAARLFVSLCIPYSLSIPILAFSGCRLTVTNDYVSSQKQKPSQRKGCLFV 331 Query: 518 CHRES--DSCIYSYAFIRKAVFTL 583 C+ + D ++A +K + T+ Sbjct: 332 CNHRTLLDPLYVAFALRKKNIKTV 355 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,568,936 Number of Sequences: 28952 Number of extensions: 359110 Number of successful extensions: 660 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1843581600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -