Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brP-0136
         (726 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY534995-1|AAT07393.1|  461|Anopheles gambiae XK-related protein.      26   1.4  

>AY534995-1|AAT07393.1|  461|Anopheles gambiae XK-related protein.
          Length = 461

 Score = 25.8 bits (54), Expect = 1.4
 Identities = 15/62 (24%), Positives = 30/62 (48%)
 Frame = -1

Query: 498 DVSTFSLVCNAISIEFKIVVSSLNTACAIFEAY*SRYIKQSVIFLVFFKANVLAIILKYI 319
           DVS + ++  AISI F++V  SL    +       R +  ++  +  F   ++  +L  +
Sbjct: 99  DVSRWDILLTAISILFRLVSISLTVLLSCEYYRNGRTVYFALTLVGLFVPGIITSLLNLL 158

Query: 318 LY 313
           +Y
Sbjct: 159 MY 160


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 723,945
Number of Sequences: 2352
Number of extensions: 15636
Number of successful extensions: 17
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74012934
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)