BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0135 (533 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24730| Best HMM Match : Kinesin (HMM E-Value=2.3e-17) 30 1.0 SB_7996| Best HMM Match : efhand (HMM E-Value=1.4) 28 5.5 SB_19811| Best HMM Match : RVT_1 (HMM E-Value=3.5e-32) 27 9.6 >SB_24730| Best HMM Match : Kinesin (HMM E-Value=2.3e-17) Length = 602 Score = 30.3 bits (65), Expect = 1.0 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +2 Query: 281 LLSKALGVDFILIVIICVNVSPKYGSDTLINLGYCLRS 394 LL+ +LG D + ++I C++ S SDTL L Y R+ Sbjct: 127 LLADSLGGDGVTLMIACISPSSSVVSDTLNTLRYANRA 164 >SB_7996| Best HMM Match : efhand (HMM E-Value=1.4) Length = 570 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Frame = +2 Query: 314 LIVIICVNVSPKYG----SDTLINLGYCLRSLVSTFLQRTPAIRESL 442 L V ICV + KYG D L N G+C +T ++ A+ + + Sbjct: 390 LQVSICVTLDHKYGLRDLIDLLSNFGFCASYFEATLYKKNAAVTQGV 436 >SB_19811| Best HMM Match : RVT_1 (HMM E-Value=3.5e-32) Length = 670 Score = 27.1 bits (57), Expect = 9.6 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = +1 Query: 280 VTV*GFRCRFYSNRHY---MCKCISKIRQRYIN*-SRLLSQVSGVNVSPKNTGDTRIVIN 447 VTV G + + NR K ++ +RQ+ I+ S SG+ ++PK GD RI ++ Sbjct: 281 VTVVGDKAPWLENRRLDKVKEKLLAMVRQKVISPVSEPTDWCSGMVIAPKRNGDVRICVD 340 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,634,826 Number of Sequences: 59808 Number of extensions: 263013 Number of successful extensions: 876 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -