BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0135 (533 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g06860.1 68415.m00768 Ulp1 protease family protein contains P... 28 3.4 At3g24065.1 68416.m03022 expressed protein ; expression supporte... 28 4.5 At2g16990.1 68415.m01959 expressed protein 27 5.9 At5g13990.1 68418.m01636 exocyst subunit EXO70 family protein co... 27 7.9 >At2g06860.1 68415.m00768 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 938 Score = 28.3 bits (60), Expect = 3.4 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +1 Query: 382 LSQVSGVNVSPKNTGDTRIVINYDYYN*FKHSTF 483 +S V+G SPK +GD V Y YY H TF Sbjct: 483 ISSVTGAVTSPKLSGDNEEVSCYPYYQ--NHYTF 514 >At3g24065.1 68416.m03022 expressed protein ; expression supported by MPSS Length = 135 Score = 27.9 bits (59), Expect = 4.5 Identities = 16/64 (25%), Positives = 38/64 (59%), Gaps = 2/64 (3%) Frame = -3 Query: 372 LINVSLPYFGD-TFTH-IMTIRIKSTPKALDSNPYYWKCFTSLI*K*NGVSMTAKSYISK 199 L++++L + +FT + T+++ + ALDS+P+ +C +S + + V ++Y+ Sbjct: 11 LVSLALAFTSSLSFTAPVFTVKVTNN-LALDSHPFTIRCTSSKLDTSSQVLFRGETYVLM 69 Query: 198 YDTE 187 +DT+ Sbjct: 70 FDTD 73 >At2g16990.1 68415.m01959 expressed protein Length = 456 Score = 27.5 bits (58), Expect = 5.9 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +2 Query: 278 GLLSKALGVDFILIVIICVNVSPKYGSDTLINLGYCL 388 G A+G+ ++++ + N+S +YG T++ L CL Sbjct: 53 GFQQVAIGMGTMIMMPVIGNLSDRYGIKTILTLPMCL 89 >At5g13990.1 68418.m01636 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 695 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 327 YV*MYLQNTAAIH*LI*VIVSGLWCQRFSKEHRRYANRYQ 446 Y+ ++ +A IH ++ WC+R S E R Y YQ Sbjct: 537 YIVQKIKGSAEIH----EVMGDTWCRRRSSELRNYHKNYQ 572 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,128,344 Number of Sequences: 28952 Number of extensions: 177645 Number of successful extensions: 329 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 329 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -