BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0133 (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 27 0.16 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 23 3.5 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 23 3.5 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 6.1 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 8.0 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 27.1 bits (57), Expect = 0.16 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -1 Query: 197 SESTGQATAASMSFG-VSANPKS*STRRLGQW 105 S STGQ A+ SFG V++ P S S+ LGQ+ Sbjct: 45 SISTGQRLPANFSFGQVNSPPSSTSSGSLGQF 76 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +1 Query: 559 VRKEIKDQSEGTQDAENKXGGFAMVHFNLF 648 V K+I+D G ++EN F ++H + + Sbjct: 347 VAKKIRDFYYGGPNSENNLDNFYLIHTDTY 376 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 22.6 bits (46), Expect = 3.5 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +1 Query: 559 VRKEIKDQSEGTQDAENKXGGFAMVHFNLF 648 V K+I+D G ++EN F ++H + + Sbjct: 349 VAKKIRDFYYGGPNSENNLDNFYLIHTDTY 378 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 461 GCHQTGFSPSPRRG 502 G H TG +PSP G Sbjct: 255 GLHATGSAPSPTAG 268 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 38 FKYNRRCLFYHSCWVTGPAFVTTT 109 F + + +FY ++G F+TTT Sbjct: 224 FSWYSKKVFYSKIIISGSIFMTTT 247 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,406 Number of Sequences: 336 Number of extensions: 3753 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -