BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0130 (632 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32653| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16) 27 9.6 >SB_32653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 381 NNKAFTIIQSIDELEQDIEHDKCHLVNYYRRDGRH 277 N +I S + L +D+ D+CH++ + R RH Sbjct: 371 NKPCCLMISSDNCLTRDVREDQCHVITFERSQKRH 405 >SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16) Length = 904 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -3 Query: 396 FLISCNNKAFTIIQSIDELEQDIEHDK 316 FL SC NK +I+ +DEL ++++DK Sbjct: 391 FLGSCYNKYTALIKIVDELLFNLDNDK 417 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,247,224 Number of Sequences: 59808 Number of extensions: 295242 Number of successful extensions: 866 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 866 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -