BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0130 (632 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061373-1|AAL28921.1| 1205|Drosophila melanogaster LD29485p pro... 31 1.3 AE014296-340|AAF47556.1| 1205|Drosophila melanogaster CG2069-PA ... 31 1.3 >AY061373-1|AAL28921.1| 1205|Drosophila melanogaster LD29485p protein. Length = 1205 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -3 Query: 282 RHLEIKNIFKH**SC*SHKKTFVTHNGIMLVINIDDNNLSAL 157 RHL ++K +C S + + H G+M ++++DDN + L Sbjct: 558 RHLMNAKVYKMAINCNSTRAAIIDHMGVMTLLDLDDNRETQL 599 >AE014296-340|AAF47556.1| 1205|Drosophila melanogaster CG2069-PA protein. Length = 1205 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -3 Query: 282 RHLEIKNIFKH**SC*SHKKTFVTHNGIMLVINIDDNNLSAL 157 RHL ++K +C S + + H G+M ++++DDN + L Sbjct: 558 RHLMNAKVYKMAINCNSTRAAIIDHMGVMTLLDLDDNRETQL 599 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,604,495 Number of Sequences: 53049 Number of extensions: 449695 Number of successful extensions: 822 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 822 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2641708800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -