BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0130 (632 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel... 29 3.4 At4g02660.1 68417.m00361 WD-40 repeat family protein / beige-rel... 28 5.9 >At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel, putative (CNGC14) similar to cyclic nucleotide and calmodulin-regulated ion channel (GI:4581205) [Arabidopsis thaliana] Length = 726 Score = 28.7 bits (61), Expect = 3.4 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +1 Query: 49 F*SNRIQQYSSRLLQHNRTYY--QWREFV*CYIPTITR 156 F +N+ ++ S+ LQH YY QWR + C++ R Sbjct: 592 FVANQFRRLHSKKLQHTFRYYSHQWRTWAACFVQVAWR 629 >At4g02660.1 68417.m00361 WD-40 repeat family protein / beige-related contains Pfam PF00400: WD domain, G-beta repeat; similar to BEIGE (GI:3928547) [Rattus norvegicus]; lysosomal trafficking regulator - Bos taurus, EMBL: AF114785 Length = 3471 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = -2 Query: 142 GYSTRRTPSTGNRF--CCAEGAG 80 GYS R+TPS NR+ C +G+G Sbjct: 470 GYSRRQTPSANNRYDEPCEQGSG 492 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,368,069 Number of Sequences: 28952 Number of extensions: 210213 Number of successful extensions: 369 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1295224128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -