BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0123 (723 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.96 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 22 5.1 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 22 6.7 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 8.9 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.6 bits (51), Expect = 0.96 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 474 PRCPFFRQRFSLRFGGYIASDEKPEK 397 P+CP FR+ S G + EKP+K Sbjct: 566 PQCPRFRKLDSPSDSGIESGTEKPDK 591 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/28 (35%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 219 FSGTMLLSEFADLLLXPWESF--PGEYF 142 F G + E++DL+ W +F PG++F Sbjct: 29 FLGWNVPPEYSDLVRPHWRAFPAPGKHF 56 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/28 (35%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 219 FSGTMLLSEFADLLLXPWESF--PGEYF 142 F G + E++DL+ W +F PG++F Sbjct: 29 FLGWNVPPEYSDLVHPHWRAFPAPGKHF 56 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +3 Query: 609 AQIQVLGVRVRRHNEPYRETARDRRHYLSQRVP 707 +Q +++ R RR+++ + + DRR S R P Sbjct: 12 SQRKIIRSRSRRYSKRFSSSIVDRRSPSSSRSP 44 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,425 Number of Sequences: 438 Number of extensions: 4361 Number of successful extensions: 33 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -