BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0119 (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457558-1|AAL68788.1| 56|Anopheles gambiae hypothetical prote... 23 7.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 9.6 >AF457558-1|AAL68788.1| 56|Anopheles gambiae hypothetical protein 11 protein. Length = 56 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 717 IVFKSXIILICLXN*CFFFYYTH 649 I F++ I L+ L C FFY+TH Sbjct: 3 IFFQAGIKLLVLLI-CLFFYHTH 24 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.0 bits (47), Expect = 9.6 Identities = 11/42 (26%), Positives = 19/42 (45%) Frame = +2 Query: 194 FAVYHAALE*VSLYGVSNEACEDYIIPASSMALLCSIADVHG 319 FA+Y+ + V Y S C ++ ++ L + VHG Sbjct: 1959 FALYNYIIGYVMFYVRSTHECSQQLVGSALSVLWMVVHSVHG 2000 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 718,905 Number of Sequences: 2352 Number of extensions: 15597 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -