BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0119 (724 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY251274-1|AAP04412.1| 291|Homo sapiens unknown protein. 30 7.3 AK024496-1|BAB15786.1| 287|Homo sapiens FLJ00104 protein protein. 30 7.3 >AY251274-1|AAP04412.1| 291|Homo sapiens unknown protein. Length = 291 Score = 30.3 bits (65), Expect = 7.3 Identities = 21/67 (31%), Positives = 28/67 (41%), Gaps = 4/67 (5%) Frame = -3 Query: 299 CKAEPCCWLELCNLHKPRLKHRRGK----LIPKPHGTRQKRSLETHCL*SQWFQVARMNS 132 CK P CW ELC + K R + L+ P G R ++S H L S+ Sbjct: 165 CKELPGCWAELCCRPRKMTKKDRAEPHLPLLGGPEGARAQQSPILHSLGSKRLPRCGWQL 224 Query: 131 TPVAGGA 111 +GGA Sbjct: 225 LTSSGGA 231 >AK024496-1|BAB15786.1| 287|Homo sapiens FLJ00104 protein protein. Length = 287 Score = 30.3 bits (65), Expect = 7.3 Identities = 21/67 (31%), Positives = 28/67 (41%), Gaps = 4/67 (5%) Frame = -3 Query: 299 CKAEPCCWLELCNLHKPRLKHRRGK----LIPKPHGTRQKRSLETHCL*SQWFQVARMNS 132 CK P CW ELC + K R + L+ P G R ++S H L S+ Sbjct: 161 CKELPGCWAELCCRPRKMTKKDRAEPHLPLLGGPEGARAQQSPILHSLGSKRLPRCGWQL 220 Query: 131 TPVAGGA 111 +GGA Sbjct: 221 LTSSGGA 227 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,467,102 Number of Sequences: 237096 Number of extensions: 2048921 Number of successful extensions: 3605 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3605 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -