BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0114 (816 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 4.5 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 4.5 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 22 7.8 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 98 KALASQPEYTVSLER*D*AQLH*Q 27 K L QPE T+S++R +LH Q Sbjct: 371 KPLVRQPEDTMSVDRMQHCELHMQ 394 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -2 Query: 98 KALASQPEYTVSLER*D*AQLH*Q 27 K L QPE T+S++R +LH Q Sbjct: 371 KPLVRQPEDTMSVDRMQHCELHMQ 394 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.8 bits (44), Expect = 7.8 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +2 Query: 437 VIKSRGARTIRTNIINAVIYVFSYTVSNIHNKYSQTWVSENWI 565 V+ G + T I++ + V N+H + QT V W+ Sbjct: 299 VVPLLGKFVLFTMILDTFSICVTVVVLNVHFRSPQTHVMAPWV 341 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,077 Number of Sequences: 438 Number of extensions: 3823 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -