BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0108 (572 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.64 SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/F... 27 1.5 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 4.5 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 6.0 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 6.0 SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium tra... 25 6.0 SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 25 7.9 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 28.7 bits (61), Expect = 0.64 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 434 SGCGRCRVWSMFVRYVRFXE 493 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/Flp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 27.5 bits (58), Expect = 1.5 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = -2 Query: 304 ADMGTNRRDISTYIPHLNFQGPQRVSGHRRKCGAXRVPNHISL 176 A GT++ +IST +P P++VSGH A R+P+ S+ Sbjct: 371 ATNGTSQSNISTPLPEPTPGQPRKVSGHNPP-SARRLPSASSV 412 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 4.5 Identities = 17/51 (33%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = -1 Query: 212 MRCXSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRTXVFK 63 MR E Y+ + G H T Q LF D + H L RRT K Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRTGYVK 51 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 6.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 471 TNIDQTRHRPHPLPVQTRHAPV 406 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 6.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 359 FPYLHYSID*RLFTLETCCGYGYEPARHL 273 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPACUNK4.07c |cta4|sev4, SPAPYUK71.01|P-type ATPase, calcium transporting Cta4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1211 Score = 25.4 bits (53), Expect = 6.0 Identities = 17/67 (25%), Positives = 29/67 (43%) Frame = -1 Query: 236 ESIRTPPQMRCXSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHFGLPRRTXVFKDE 57 ESI P+ E ++ F GTR L+ + F L +G + RT + Sbjct: 317 ESIELRPEEAVIDVDELDKNAVLFGGTRVLQVTQSPFCKLKTPDNGVPAIVLRTGFETSQ 376 Query: 56 GTIIETV 36 G+++ T+ Sbjct: 377 GSLVRTM 383 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 25.0 bits (52), Expect = 7.9 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +1 Query: 160 PWNPIEGRYGSEREXHRI 213 P+ P+EG Y + ++ HRI Sbjct: 3 PYEPVEGLYVNAKQYHRI 20 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,342,102 Number of Sequences: 5004 Number of extensions: 47934 Number of successful extensions: 122 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -