BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0106 (724 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45284| Best HMM Match : Nucleoplasmin (HMM E-Value=8.7e-10) 38 0.011 SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_24885| Best HMM Match : HOOK (HMM E-Value=0.00023) 28 6.7 SB_8157| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_45284| Best HMM Match : Nucleoplasmin (HMM E-Value=8.7e-10) Length = 282 Score = 37.5 bits (83), Expect = 0.011 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 5/99 (5%) Frame = +1 Query: 76 EFFYGVTLSSSHQSETWDPXAKAEYPR----SNKLVIRQALLGPDAKPDELNVIQVEAMS 243 E F+G LS S + TW+P E +KLV+ QA LG +K ++++V +M Sbjct: 7 EDFWGCVLSKSEDTVTWNPEFDGEDTLLGQIEHKLVLSQACLG--SKATGKSMVEVTSMD 64 Query: 244 LQ-EAVKLPVAVLKVGESRHVRLDIEFPXAPVTFTLVXG 357 + + + L+ G + L++ F PVTF L G Sbjct: 65 FKGDDSTHTIVSLREGATEMCALNLAF-SPPVTFKLASG 102 >SB_13096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1465 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -3 Query: 347 RVNVTGAXGNSMSRRTCLDSPTFNTATGSFTASCSDMASTC 225 RVN+T G + RTC +P S ++ SD + TC Sbjct: 821 RVNITKCNGTNAQSRTCAFAPCPVNGAWSSWSAWSDCSKTC 861 >SB_24885| Best HMM Match : HOOK (HMM E-Value=0.00023) Length = 873 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 160 NKLVIRQALLGPDAKPDELNVIQVEAMSLQ 249 NKLV+ Q LLG AK + + +++ E L+ Sbjct: 304 NKLVLEQQLLGLSAKEERIEILEEENKKLK 333 >SB_8157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 405 Score = 27.9 bits (59), Expect = 8.8 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 305 RTCLDSPTFNTATGSFTASCSDMASTC 225 R C D T+ TGS C D++STC Sbjct: 284 RYCYDDMTWQPITGSPRRFCLDVSSTC 310 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,180,324 Number of Sequences: 59808 Number of extensions: 302278 Number of successful extensions: 623 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 623 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -