BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0106 (724 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 25 3.1 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 24 5.5 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 7.2 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 24.6 bits (51), Expect = 3.1 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 Query: 349 VXGSGPVHLIG 381 + GSGPVHLIG Sbjct: 194 IAGSGPVHLIG 204 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 Query: 77 SFSMVSPFHHHISQRHGIQ 133 S S SPFHHH Q+ Q Sbjct: 19 SSSQRSPFHHHHQQQQNHQ 37 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.4 bits (48), Expect = 7.2 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = -3 Query: 296 LDSPTFNTATGSFTASCSDMASTCITFNSSGLASGPNNA*RMTSLLLRGYS 144 LD+ + + + S C CITF+ S +A R + + RG S Sbjct: 305 LDTKSKPSTSSSSGTGCDRDDGDCITFDDSASVVRATHASRSATRMSRGRS 355 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,180 Number of Sequences: 2352 Number of extensions: 10669 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -