BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0106 (724 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016445-9|AAC69061.1| 156|Caenorhabditis elegans Hypothetical ... 31 0.83 U70856-4|AAB09167.1| 2090|Caenorhabditis elegans Hypothetical pr... 29 4.4 U70856-3|AAB09166.1| 2153|Caenorhabditis elegans Gei-4(four) int... 29 4.4 >AF016445-9|AAC69061.1| 156|Caenorhabditis elegans Hypothetical protein T05B4.13 protein. Length = 156 Score = 31.1 bits (67), Expect = 0.83 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -3 Query: 320 NSMSRRTCLDSPTFNTATGSFTASCSDMASTCITFN--SSGLAS 195 N+ +RTC P+ TA+ S TAS S STC ++N SS L S Sbjct: 87 NTYCQRTCGRCPSSTTASSSSTASSS---STCTSYNADSSSLCS 127 >U70856-4|AAB09167.1| 2090|Caenorhabditis elegans Hypothetical protein F57F4.4 protein. Length = 2090 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 297 ACTS--GH*IPXCACYIYSCSXFGASTLNWTPSPW 395 ACT+ G I C CY C+ TPSPW Sbjct: 185 ACTNLAGTNIQGCCCYKQDCTSLAPMNNPPTPSPW 219 >U70856-3|AAB09166.1| 2153|Caenorhabditis elegans Gei-4(four) interacting proteinprotein 1 protein. Length = 2153 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 297 ACTS--GH*IPXCACYIYSCSXFGASTLNWTPSPW 395 ACT+ G I C CY C+ TPSPW Sbjct: 185 ACTNLAGTNIQGCCCYKQDCTSLAPMNNPPTPSPW 219 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,360,530 Number of Sequences: 27780 Number of extensions: 229118 Number of successful extensions: 455 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1697838058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -