BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0100 (724 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 1.7 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 2.9 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.8 bits (49), Expect = 1.7 Identities = 19/72 (26%), Positives = 28/72 (38%), Gaps = 1/72 (1%) Frame = +3 Query: 453 HEAVEXKLRATDRQ*TAFTHELATKPNPLSDTPALTTRGHDTTSRLVLLQRKTN-SINMI 629 H+ + K++ T L + + P +T GH + LL N SI Sbjct: 114 HKFISKKIKKTMENKDITKRPLPNESQLIKRHPIVTIMGHVDHGKTTLLDALRNTSIAKS 173 Query: 630 DFTGGRTSCESA 665 +F GG T C A Sbjct: 174 EF-GGITQCIGA 184 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 289 VPWHWCVYSKSNRPYLH 239 +P HW VY + N P LH Sbjct: 33 IPEHWLVYPEPN-PSLH 48 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,741 Number of Sequences: 438 Number of extensions: 3484 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -