BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0099 (723 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) 92 4e-19 SB_641| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_35576| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 47 1e-05 SB_10498| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-07) 47 1e-05 SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) 45 5e-05 SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) 45 5e-05 SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) 44 9e-05 SB_55149| Best HMM Match : Ldl_recept_a (HMM E-Value=2.6e-23) 44 1e-04 SB_47409| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-17) 44 2e-04 SB_50311| Best HMM Match : Ldl_recept_a (HMM E-Value=3.4e-20) 43 2e-04 SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4238| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21487| Best HMM Match : MAM (HMM E-Value=0) 43 3e-04 SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) 42 4e-04 SB_29580| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-38) 42 4e-04 SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) 42 4e-04 SB_20531| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43823| Best HMM Match : MAM (HMM E-Value=0) 42 7e-04 SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 41 0.001 SB_5319| Best HMM Match : Ldl_recept_a (HMM E-Value=7.56701e-44) 41 0.001 SB_18178| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) 40 0.003 SB_6273| Best HMM Match : MAM (HMM E-Value=0) 40 0.003 SB_19614| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_51898| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45605| Best HMM Match : MAM (HMM E-Value=2.1e-16) 38 0.008 SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_18810| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_35350| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_23898| Best HMM Match : Ldl_recept_a (HMM E-Value=1.4013e-45) 37 0.014 SB_31087| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-32) 37 0.019 SB_2014| Best HMM Match : MAM (HMM E-Value=0) 36 0.025 SB_13199| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.044 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_28040| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) 35 0.058 SB_8478| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.058 SB_31927| Best HMM Match : Ldl_recept_a (HMM E-Value=2.3e-27) 35 0.077 SB_43556| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-11) 34 0.10 SB_22727| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.10 SB_43832| Best HMM Match : CBM_14 (HMM E-Value=2.8e-16) 34 0.13 SB_40871| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_13694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_33423| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-22) 33 0.23 SB_3253| Best HMM Match : Ldl_recept_a (HMM E-Value=0.00064) 32 0.41 SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) 32 0.41 SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) 32 0.41 SB_58073| Best HMM Match : CBM_14 (HMM E-Value=1.4e-17) 32 0.54 SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) 32 0.54 SB_4518| Best HMM Match : CBM_14 (HMM E-Value=0.019) 32 0.54 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_26126| Best HMM Match : Ldl_recept_b (HMM E-Value=3e-24) 31 0.95 SB_16363| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_31319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_17635| Best HMM Match : CUB (HMM E-Value=0) 30 2.2 SB_7335| Best HMM Match : TSP_1 (HMM E-Value=0) 29 3.8 SB_1784| Best HMM Match : CBM_14 (HMM E-Value=7e-18) 29 3.8 SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_11110| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_38846| Best HMM Match : Cache (HMM E-Value=2.7e-09) 28 8.8 SB_5369| Best HMM Match : wnt (HMM E-Value=2.9e-18) 28 8.8 SB_26236| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) Length = 893 Score = 92.3 bits (219), Expect = 4e-19 Identities = 40/81 (49%), Positives = 54/81 (66%) Frame = +2 Query: 464 APDCDPNXCVLPDCFCSADGTRIPGGIEPNQVPQMXTITFNGAVNVDNIDLYXQIFNGNR 643 A C P+ C LP+CFCS G +PGG+ P ++PQM +TF+ A+N +Y +IFNG + Sbjct: 566 AERCHPDVCKLPNCFCS--GALVPGGLNPKEIPQMIMLTFDDAINGQVYPVYQKIFNGKK 623 Query: 644 HNPNGXQIKGTFFVSHKXTNY 706 NPNG I+ TFFVSH+ T Y Sbjct: 624 -NPNGCDIRATFFVSHEYTQY 643 >SB_641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 530 Score = 70.1 bits (164), Expect = 2e-12 Identities = 36/83 (43%), Positives = 44/83 (53%) Frame = +2 Query: 458 NRAPDCDPNXCVLPDCFCSADGTRIPGGIEPNQVPQMXTITFNGAVNVDNIDLYXQIFNG 637 N A CD C P+C CS D + PGG+ P PQ+ ITF+ + V N + Y G Sbjct: 25 NVAEKCDLEKCQPPNCRCS-DDFQPPGGLSPALTPQIIMITFDDDITVINYEQYKDAVKG 83 Query: 638 NRHNPNGXQIKGTFFVSHKXTNY 706 NPNG I TFF+SH TNY Sbjct: 84 FT-NPNGCPITATFFISHNYTNY 105 >SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1769 Score = 66.9 bits (156), Expect = 2e-11 Identities = 26/62 (41%), Positives = 40/62 (64%) Frame = +2 Query: 521 GTRIPGGIEPNQVPQMXTITFNGAVNVDNIDLYXQIFNGNRHNPNGXQIKGTFFVSHKXT 700 G +P G++P Q+PQM +TF+ A+N+ Y + N + NPNG ++ TFFVSH+ T Sbjct: 1553 GASVPNGLDPKQIPQMIMLTFDDAINMQVFPFYQTLLNDTK-NPNGCNVRATFFVSHEYT 1611 Query: 701 NY 706 +Y Sbjct: 1612 DY 1613 >SB_35576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1315 Score = 47.6 bits (108), Expect = 1e-05 Identities = 27/73 (36%), Positives = 33/73 (45%), Gaps = 5/73 (6%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C K AC SG+CI+ C+G DCKD SDE+ C + + C CV C Sbjct: 1155 CLSSKFACESGECIDVVGLCDGTDDCKDASDESRCDHKCSKDEY-QCVSGACVKWPLTCD 1213 Query: 515 A-----DGTRIPG 538 DGT PG Sbjct: 1214 GKKDCEDGTDEPG 1226 Score = 36.7 bits (81), Expect = 0.019 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = +2 Query: 305 LPILKTDEPICPEX--KLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCD 478 LP+ CP+ + C +G C+ ++L C+G C D SDE C L A C+ Sbjct: 1107 LPVHSVPGFRCPDKSTQFQCVNGQCVSRDLICDGDNACLDFSDEANCKC-LSSKFA--CE 1163 Query: 479 PNXCVLPDCFCSADGT 526 C+ D DGT Sbjct: 1164 SGECI--DVVGLCDGT 1177 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/62 (32%), Positives = 26/62 (41%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C + C +G CI +E C+ + DC D SDE C PN C C+ C Sbjct: 2457 CDVTQFRCKTGTCITREWRCDHQDDCGDGSDEQQCVNYTCPNHTFKCTSGHCIANSSVCD 2516 Query: 515 AD 520 D Sbjct: 2517 GD 2518 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDE-NACTVEL-DPNRAPDCDPNXCV 493 CP K C +G CI K C+G+ DC D SDE + C+ + DP C C+ Sbjct: 47 CPPTKFLCANGMCIPKSAVCDGENDCGDMSDEPSNCSAHICDPKLEFQCANGRCI 101 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/100 (27%), Positives = 39/100 (39%), Gaps = 2/100 (2%) Frame = +2 Query: 227 FDLDKQTCDWKGKVNNCDKLXKPRKVLPILKTDEPICPEXKLACGSGDCIEKELFCNGKP 406 F D C ++ +V CD + R C + C SG CI ++ C+G Sbjct: 3012 FRCDNFRCVYRSRV--CDGIDDCRDGSDERNCHVTTCTADQFRCPSGRCISRDWLCDGDN 3069 Query: 407 DCKDESDENA--CTVELDPNRAPDCDPNXCVLPDCFCSAD 520 DC D SDE A C V +A C+ + C + Sbjct: 3070 DCGDSSDEKAGECHVTCPAGQARCATGRRCIPSEWRCDGE 3109 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Frame = +2 Query: 326 EPICPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC-TVELDPNRAPDCDPNXCVLPD 502 E CP + C +G C+ + C+G+ DC D SDE C P + N C+ Sbjct: 2245 EVTCPAHEFTCPNGRCVSYDFLCDGEDDCGDFSDELRCPPTTCVPGQVKCGSKNLCIPSS 2304 Query: 503 CFC 511 C Sbjct: 2305 WLC 2307 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/62 (30%), Positives = 25/62 (40%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C +C +G CI + C+ + DC D SDE C P C CV D C Sbjct: 2209 CEPGHFSCNNGRCINAKWVCDRENDCGDNSDEARCPEVTCPAHEFTCPNGRCVSYDFLCD 2268 Query: 515 AD 520 + Sbjct: 2269 GE 2270 Score = 41.9 bits (94), Expect = 5e-04 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +2 Query: 332 IC-PEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 IC P+ + C +G CI K+ C+G DC D SDE+ C Sbjct: 86 ICDPKLEFQCANGRCINKKWRCDGMKDCADGSDESTC 122 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENA 436 C + AC SG C+ K C+G DC D SDE++ Sbjct: 2168 CASSEFACESGQCVRKSFVCDGDNDCHDGSDESS 2201 Score = 41.1 bits (92), Expect = 9e-04 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 CP C SG CI C+G DC D SDE C Sbjct: 2496 CPNHTFKCTSGHCIANSSVCDGDTDCADGSDEKDC 2530 Score = 40.7 bits (91), Expect = 0.001 Identities = 27/76 (35%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +2 Query: 209 CPSGLAFD-LDKQTCDWKGKVNNCDKLXKPRKVLPILKTDEPICPEXKLACGSGDCIEKE 385 CP G+A D LD +TC+ K V+P P C K C +G CI Sbjct: 799 CPYGMALDQLDNKTCE------------KNFTVIPT-----PPCSAGKFTCKNGHCISLR 841 Query: 386 LFCNGKPDCKDESDEN 433 C+G+ DC D SDE+ Sbjct: 842 WKCDGENDCVDNSDED 857 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +2 Query: 335 CPEXKLACGSG-DCIEKELFCNGKPDCKDESDENACTVELDPNRAPDC-DPNXCVLPDCF 508 C + AC +G CI+++ C+G+ DC D SDE C +E N C + + C+ Sbjct: 1087 CKPFEFACANGRHCIQRKWICDGENDCGDRSDEVDCGLESCGNDRWRCSNTSRCIAKSQV 1146 Query: 509 C 511 C Sbjct: 1147 C 1147 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/62 (29%), Positives = 24/62 (38%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C C + C+ + C+G DC+D SDE C V C C+ D C Sbjct: 3007 CAPYHFRCDNFRCVYRSRVCDGIDDCRDGSDERNCHVTTCTADQFRCPSGRCISRDWLCD 3066 Query: 515 AD 520 D Sbjct: 3067 GD 3068 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCV 493 C + + +C G CI + C+G DC D SDE P R C + CV Sbjct: 3207 CADGQFSCDDGLCIARAWKCDGMMDCADASDEKGSGHRWCPQRLYQCINHVCV 3259 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/53 (32%), Positives = 22/53 (41%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCV 493 C + + C SG CI C+ DC D SDE C + CD C+ Sbjct: 3168 CAKHQYRCASGRCISASWVCDHVNDCGDGSDEQQCINRTCADGQFSCDDGLCI 3220 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDE 430 C + AC +G CI L C+G DC D SDE Sbjct: 2370 CTGAQFACDNGRCISTRLLCDGDNDCGDNSDE 2401 Score = 36.7 bits (81), Expect = 0.019 Identities = 45/175 (25%), Positives = 59/175 (33%), Gaps = 7/175 (4%) Frame = +2 Query: 89 EPNADQLCDGRPADEYFRLTTEXDC---RDVVRCTR--SGLKQITCPSGLAFDLDKQTCD 253 EP +GR + + E DC D RC + TCP+G D CD Sbjct: 2210 EPGHFSCNNGRCINAKWVCDRENDCGDNSDEARCPEVTCPAHEFTCPNGRCVSYDF-LCD 2268 Query: 254 WKGKVNNCDKLXKPRKVLPILKTDEPICPEXKLACGSGD-CIEKELFCNGKPDCKDESDE 430 + ++C + P C ++ CGS + CI C+G DC D DE Sbjct: 2269 GE---DDCGDFSDELRCPPTT------CVPGQVKCGSKNLCIPSSWLCDGSDDCGDGWDE 2319 Query: 431 NACTVELDPNRAP-DCDPNXCVLPDCFCSADGTRIPGGIEPNQVPQMXTITFNGA 592 E N + C CV C D EP Q T GA Sbjct: 2320 RQDCRERPCNVSEFRCTSGECVPASWRCDGDNDCTDKSDEPTDC-QRSNATCTGA 2373 Score = 36.7 bits (81), Expect = 0.019 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDE--NACTVELDPNRAPDCDPNXCV 493 CP+ C + C+++ C+ DC D SDE C + N CD N C+ Sbjct: 3246 CPQRLYQCINHVCVDRRWLCDDMDDCGDYSDELRLLCRYSICRNSHFRCDNNKCI 3300 Score = 35.9 bits (79), Expect = 0.033 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C C +G C ++ C+G DC D SDE C Sbjct: 910 CSASMFRCANGQCKPRDWVCDGFDDCGDGSDEKGC 944 Score = 35.9 bits (79), Expect = 0.033 Identities = 36/145 (24%), Positives = 53/145 (36%), Gaps = 7/145 (4%) Frame = +2 Query: 98 ADQL-C-DGRPADEYFRLTTEXDCRDVVRCTRSGLKQITCPSGLAFDLDKQTC---DWK- 259 ADQ C GR + + DC D ++G +TCP+G A + C +W+ Sbjct: 3048 ADQFRCPSGRCISRDWLCDGDNDCGDSSD-EKAGECHVTCPAGQARCATGRRCIPSEWRC 3106 Query: 260 GKVNNCDKLXKPRKVLPILKTDEPICPEXKLACGSGD-CIEKELFCNGKPDCKDESDENA 436 ++C+ T C C S CI + C+G+ DC D SDE Sbjct: 3107 DGESDCEDGSDENSAQCTAIT----CSAETFRCYSDRRCIPNQWKCDGESDCNDGSDEKG 3162 Query: 437 CTVELDPNRAPDCDPNXCVLPDCFC 511 C + C C+ C Sbjct: 3163 CPPKQCAKHQYRCASGRCISASWVC 3187 Score = 35.5 bits (78), Expect = 0.044 Identities = 18/65 (27%), Positives = 25/65 (38%), Gaps = 3/65 (4%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAP---DCDPNXCVLPDC 505 C + C SG+C+ C+G DC D+SDE + CD C+ Sbjct: 2328 CNVSEFRCTSGECVPASWRCDGDNDCTDKSDEPTDCQRSNATCTGAQFACDNGRCISTRL 2387 Query: 506 FCSAD 520 C D Sbjct: 2388 LCDGD 2392 Score = 32.7 bits (71), Expect = 0.31 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDE-NACTVEL-DPNRAPDCDPNXCV 493 C C + CI + C+G+ DC D SDE ++C V + P D C+ Sbjct: 2926 CTNNDFMCDNYRCISRLWRCDGEDDCGDGSDEPDSCPVRVCKPGTYQCADNRKCI 2980 Score = 31.1 bits (67), Expect = 0.95 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 335 CPEXKLACG-SGDCIEKELFCNGKPDCKDESDENACT 442 C + C S CI C+ DC D SDE CT Sbjct: 1047 CHSTEFQCETSSRCIPLRFVCDADDDCGDRSDERNCT 1083 Score = 31.1 bits (67), Expect = 0.95 Identities = 29/125 (23%), Positives = 48/125 (38%), Gaps = 6/125 (4%) Frame = +2 Query: 74 DGAGDEPNADQLC-DGR-PADEYFRLTTEXDCRDVVRCT----RSGLKQITCPSGLAFDL 235 DG+ ++ ++ C DG+ D+ + C ++ C G CP L + Sbjct: 3195 DGSDEQQCINRTCADGQFSCDDGLCIARAWKCDGMMDCADASDEKGSGHRWCPQRLYQCI 3254 Query: 236 DKQTCDWKGKVNNCDKLXKPRKVLPILKTDEPICPEXKLACGSGDCIEKELFCNGKPDCK 415 + D + ++ D L +L IC C + CI K C+G C Sbjct: 3255 NHVCVDRRWLCDDMDDCGDYSDELRLL-CRYSICRNSHFRCDNNKCIPKWNVCDGVYHCT 3313 Query: 416 DESDE 430 D+SDE Sbjct: 3314 DKSDE 3318 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 335 CPEXKLACGSGD-CIEKELFCNGKPDCKDESDE 430 C + C + CI K C+G+ DC D SDE Sbjct: 1127 CGNDRWRCSNTSRCIAKSQVCDGRVDCPDASDE 1159 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 326 EPICPEXKLAC-GSGDCIEKELFCNGKPDCKDESDENACTVELD 454 E C + C G+ CI C+G DC D DE + ++LD Sbjct: 124 EGTCRPDEWHCIGTSRCIPLSRVCDGTNDCGDNYDEGSHCLDLD 167 Score = 29.9 bits (64), Expect = 2.2 Identities = 32/121 (26%), Positives = 49/121 (40%), Gaps = 3/121 (2%) Frame = +2 Query: 80 AGDEPNADQLCDGRPADEYFRLTTEXDC-RDVVRCTRSGLKQITCPSGLAFDLDKQTCDW 256 +G+ A CDG D + DC R CT + Q C +G + CD Sbjct: 2337 SGECVPASWRCDG-DNDCTDKSDEPTDCQRSNATCTGA---QFACDNGRCIST-RLLCDG 2391 Query: 257 KGKVNNC-DKLXKPRKVLPILKTDEPICPEXKLACGSGD-CIEKELFCNGKPDCKDESDE 430 N+C D + P ++ C + + +C S C+ C+G+ DC D SDE Sbjct: 2392 D---NDCGDNSDETTLQFPCVRHRN--CTQSEYSCRSTSRCVPLAFVCDGENDCGDGSDE 2446 Query: 431 N 433 + Sbjct: 2447 S 2447 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + + C + C+ C+ DC D SDE C Sbjct: 3330 CRKDQFKCLNRRCVPVRAVCDSNDDCGDISDELQC 3364 >SB_10498| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-07) Length = 106 Score = 47.2 bits (107), Expect = 1e-05 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 CP K C G CI++ CNGK DC D SDE C Sbjct: 4 CPGSKYECRDGTCIDRNEHCNGKIDCPDASDEKGC 38 >SB_48688| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-26) Length = 351 Score = 45.2 bits (102), Expect = 5e-05 Identities = 23/72 (31%), Positives = 28/72 (38%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C + C G C+ FCNG+ DC D SDE +C A C CV C+ Sbjct: 74 CRSAEFKCPDGKCVHPSKFCNGESDCTDGSDEWSCDNSCSSRHA--CADGTCVTWSLTCN 131 Query: 515 ADGTRIPGGIEP 550 G EP Sbjct: 132 GVSDCQDGSDEP 143 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/71 (30%), Positives = 31/71 (43%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C + C +G C+ +E+ C+G C D SDE C + PD CV P FC+ Sbjct: 38 CHGDQFQCLNGMCVGQEVRCDGDYACVDHSDERNCACRSAEFKCPD---GKCVHPSKFCN 94 Query: 515 ADGTRIPGGIE 547 + G E Sbjct: 95 GESDCTDGSDE 105 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = +2 Query: 353 ACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCV 493 AC G C+ L CNG DC+D SDE + D R P P C+ Sbjct: 117 ACADGTCVTWSLTCNGVSDCQDGSDEPKLCGKHDTMRPPPW-PRPCI 162 >SB_30577| Best HMM Match : Ldl_recept_a (HMM E-Value=2.8e-25) Length = 147 Score = 45.2 bits (102), Expect = 5e-05 Identities = 23/72 (31%), Positives = 28/72 (38%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C + C G C+ FCNG+ DC D SDE +C A C CV C+ Sbjct: 74 CRSAEFKCPDGKCVHPSKFCNGESDCTDGSDEWSCDNSCSSRHA--CADGTCVTWSLTCN 131 Query: 515 ADGTRIPGGIEP 550 G EP Sbjct: 132 GVSDCQDGSDEP 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 23/71 (32%), Positives = 31/71 (43%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C + C +G C+ +EL C+G C D SDE C + PD CV P FC+ Sbjct: 38 CHGDQFQCLNGMCVGQELRCDGDYACVDHSDERNCACRSAEFKCPD---GKCVHPSKFCN 94 Query: 515 ADGTRIPGGIE 547 + G E Sbjct: 95 GESDCTDGSDE 105 >SB_45709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 44.4 bits (100), Expect = 9e-05 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNR 463 C + C +G CI+ C+G DC+D SDE C + L P R Sbjct: 130 CDPSQHTCNNGQCIKASWLCDGASDCQDNSDEMNCPLTLAPGR 172 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/76 (32%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = +2 Query: 314 LKTDEPICPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAP-DCDPNXC 490 L T + P C +G C+ KE C+G DC D SDE+ C P R P C P+ Sbjct: 294 LSTAKTCNPVTDHTCRNGRCVLKEWLCDGMDDCGDSSDEDNC-----PTRPPYTCPPSDF 348 Query: 491 VLPDCFCSADGTRIPG 538 + C + R G Sbjct: 349 TCANSQCVPNSFRCDG 364 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/64 (29%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC--TVELDPNRAPDCDPNXCVLPDCF 508 CP C + C+ C+G+ DC D SDE+ C T N CD C+ Sbjct: 343 CPPSDFTCANSQCVPNSFRCDGENDCGDRSDESGCKPTTTCSANEF-RCDDGRCITSTFR 401 Query: 509 CSAD 520 C + Sbjct: 402 CDRE 405 Score = 39.1 bits (87), Expect = 0.004 Identities = 39/140 (27%), Positives = 47/140 (33%), Gaps = 3/140 (2%) Frame = +2 Query: 92 PNADQLC-DGRPADEYFRLTTEXDCRDVVRCTRSGLKQITCPSGLAFDLDKQTCDWKGKV 268 P +D C + + FR E DC D R SG K T S F D C Sbjct: 344 PPSDFTCANSQCVPNSFRCDGENDCGD--RSDESGCKPTTTCSANEFRCDDGRCITS--T 399 Query: 269 NNCDKLXKPRKVLPILKTDEPICPEXKLACG-SGDCIEKELFCNGKPDCKDESDENACTV 445 CD+ C + C SG CI C+ + DC D SDE C Sbjct: 400 FRCDREFDCTDRSDERGCVNKTCAPYEFTCAFSGRCIPGRFRCDHRSDCLDGSDEQNCQN 459 Query: 446 ELDPNRAP-DCDPNXCVLPD 502 P P C N + D Sbjct: 460 VTRPTPPPVKCRKNERMCAD 479 Score = 37.1 bits (82), Expect = 0.014 Identities = 34/119 (28%), Positives = 47/119 (39%), Gaps = 10/119 (8%) Frame = +2 Query: 113 DGRPADEYFRLTTEXDCRDVVRCTRSGLKQITCPS---GLAFD----LDKQTCDWKGK-V 268 DGR FR E DC D R G TC AF + CD + + Sbjct: 392 DGRCITSTFRCDREFDCTD--RSDERGCVNKTCAPYEFTCAFSGRCIPGRFRCDHRSDCL 449 Query: 269 NNCDKLXKPRKVLPILKTDEPI-CPEXKLACGSGD-CIEKELFCNGKPDCKDESDENAC 439 + D+ P T P+ C + + C G+ C+ + C+G+ DC D SDE C Sbjct: 450 DGSDEQNCQNVTRP---TPPPVKCRKNERMCADGNGCVHRRWICDGERDCLDGSDEAGC 505 Score = 32.7 bits (71), Expect = 0.31 Identities = 22/72 (30%), Positives = 29/72 (40%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C + C + CI C+G +C D SDE C P+ P P+ P S Sbjct: 510 CSSDEFTCTNQKCIPLPQKCDGTDNCGDGSDEKMCPT---PSVPP--QPDIAYQP---VS 561 Query: 515 ADGTRIPGGIEP 550 D T PG + P Sbjct: 562 GDNTTQPGQVCP 573 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 332 ICPEXKLACGSGD-CIEKELFCNGKPDCKDESDENAC 439 +CP CGS CI C+ P C DE C Sbjct: 571 VCPRDHFRCGSSTICIANSKVCDATPHCPHGEDERNC 607 >SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) Length = 262 Score = 44.4 bits (100), Expect = 9e-05 Identities = 22/68 (32%), Positives = 26/68 (38%) Frame = +2 Query: 317 KTDEPICPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVL 496 KT C + CG+G CI C+ DC D SDEN C CD C+ Sbjct: 182 KTLSGTCAPGQFKCGNGKCIPSSWKCDHDNDCGDNSDENNCPYSTCNPSQFKCDNGRCIS 241 Query: 497 PDCFCSAD 520 C D Sbjct: 242 SKWRCDHD 249 Score = 32.7 bits (71), Expect = 0.31 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C +G CI + C+ DC D SDE C Sbjct: 227 CNPSQFKCDNGRCISSKWRCDHDNDCGDMSDERNC 261 >SB_55149| Best HMM Match : Ldl_recept_a (HMM E-Value=2.6e-23) Length = 190 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Frame = +2 Query: 335 CPEXKLACGS-GDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFC 511 C C S G CI K C+G+ DC D SDE C ++ +C+ N CV C Sbjct: 90 CGSRHFKCVSDGKCIPKSWRCDGEMDCPDSSDEEGCVNRTCSSKEFNCN-NQCVPLSWKC 148 Query: 512 SADGTRIPGGIE 547 + PGG + Sbjct: 149 DGEKDCRPGGFD 160 >SB_47409| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-17) Length = 1571 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +2 Query: 329 PICPEXKLACG-SGDCIEKELFCNGKPDCKDESDENACTV-ELDPNRAPDCDPNXCVLPD 502 P C + CG G+C+ + L CNG+ DC+D SDE C + + AP VL D Sbjct: 724 PGCGNGEFYCGVPGECVPQTLRCNGQMDCRDASDEQDCGIPTVTTTSAPQPTKGKTVLGD 783 Score = 31.9 bits (69), Expect = 0.54 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 6/42 (14%) Frame = +2 Query: 332 ICPEXKLACGSG-----DCIEKELFCNGKPDCKDES-DENAC 439 +CP CG+G CI K L CNG DC DE+ C Sbjct: 1529 LCPSGYFYCGTGPKGEISCITKALRCNGIYDCSVTGWDEDGC 1570 >SB_50311| Best HMM Match : Ldl_recept_a (HMM E-Value=3.4e-20) Length = 772 Score = 43.2 bits (97), Expect = 2e-04 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 CP C SG+CI C+GK DC D +DE C Sbjct: 127 CPSNMFLCPSGECIMGTQLCDGKKDCTDNTDEKNC 161 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/59 (32%), Positives = 26/59 (44%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFC 511 C + C +G CI K L+C+G C D SDE C P+ C C++ C Sbjct: 91 CGSGEFQCDNGKCIRKNLYCDGDFACVDGSDETRCEC---PSNMFLCPSGECIMGTQLC 146 >SB_56441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/35 (48%), Positives = 20/35 (57%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C SG+CIE FC+GK DC D DE C Sbjct: 696 CGLHEFQCSSGECIEVATFCDGKKDCGDGFDETHC 730 Score = 42.7 bits (96), Expect = 3e-04 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +2 Query: 308 PILKTDEPICPEXKLACGSGDCIEKELFCNGKPD-CKDESDENACTVELDPNRAPDCDPN 484 P++ C + C +G+C+ K CNG D C D SDE+ CT L + C Sbjct: 650 PVIAEPGYKCLDHLFTCNNGECVTKTSRCNGMRDSCVDGSDESGCTCGLHEFQ---CSSG 706 Query: 485 XCVLPDCFC 511 C+ FC Sbjct: 707 ECIEVATFC 715 >SB_4238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1288 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/62 (30%), Positives = 26/62 (41%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C E ++ CG+G C+ K C+ DC D +DE C C C+L C Sbjct: 667 CSENEITCGNGICVVKRWVCDQDDDCGDGTDELNCAPHTCRPNEFTCADKRCILSRWRCD 726 Query: 515 AD 520 D Sbjct: 727 GD 728 Score = 42.3 bits (95), Expect = 4e-04 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C +G+CI K C+G+ DC ++SDEN C Sbjct: 747 CKSSEYQCSTGECIHKSWVCDGEFDCLNKSDENNC 781 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/76 (30%), Positives = 30/76 (39%), Gaps = 1/76 (1%) Frame = +2 Query: 338 PEXKLACGSGDCIEKELFCNGKPDCKDESDE-NACTVELDPNRAPDCDPNXCVLPDCFCS 514 P+ + C +G CI + C+ DC D SDE N+C C CV+ C Sbjct: 628 PDTQFRCTNGRCIPRRWVCDKDDDCHDGSDERNSCATMTCSENEITCGNGICVVKRWVCD 687 Query: 515 ADGTRIPGGIEPNQVP 562 D G E N P Sbjct: 688 QDDDCGDGTDELNCAP 703 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +2 Query: 332 ICPEXKLACGSG-DCIEKELFCNGKPDCKDESDE--NACTVELDPNRAP 469 IC + + CGS CI + C+G DC + +DE N E N P Sbjct: 788 ICKDGEFQCGSSKQCIPESKVCDGSVDCTNSADEPDNCFINECKDNNGP 836 Score = 33.1 bits (72), Expect = 0.23 Identities = 20/67 (29%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = +2 Query: 371 CIEKELFCNGKPDCKDESDENAC-TVELDPNRAPDCDPNXCVLPDCFCSADGTRIPGGIE 547 CI C+G+ DC D SDE C +P+ C C+ C D G E Sbjct: 599 CIAATWKCDGEDDCGDNSDEINCPKATCNPDTQFRCTNGRCIPRRWVCDKDDDCHDGSDE 658 Query: 548 PNQVPQM 568 N M Sbjct: 659 RNSCATM 665 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/64 (25%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC--TVELDPNRAPDCDPNXCVLPDCF 508 C + C CI C+G DC D SDE C + + + C C+ Sbjct: 706 CRPNEFTCADKRCILSRWRCDGDRDCADNSDEINCPNSSQYCKSSEYQCSTGECIHKSWV 765 Query: 509 CSAD 520 C + Sbjct: 766 CDGE 769 >SB_21487| Best HMM Match : MAM (HMM E-Value=0) Length = 874 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/43 (44%), Positives = 23/43 (53%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNR 463 C C SG+CI +L C+ DC D SDE C V+ DP R Sbjct: 704 CTPESYKCRSGECISLDLLCDFNKDCLDGSDEENCGVQ-DPGR 745 >SB_53569| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 921 Score = 42.3 bits (95), Expect = 4e-04 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +2 Query: 341 EXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDP 457 + +L C +G C +K +C+G+ DC D SDE C+ +P Sbjct: 226 DKQLRCDNGRCEDKRWWCDGQDDCNDGSDEKNCSASANP 264 >SB_29580| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-38) Length = 130 Score = 42.3 bits (95), Expect = 4e-04 Identities = 34/121 (28%), Positives = 48/121 (39%), Gaps = 12/121 (9%) Frame = +2 Query: 113 DGRPADEYFRLTTEXDC---RDVVRCTRSGLK--QITCPSGLAFDLDKQTCDWKGKVN-- 271 +GR FR E DC D C+R + Q C + + CD K + Sbjct: 13 NGRCITRAFRCDDEDDCLDNSDEQGCSRKVCRDDQFQCGTSRKCIRKSKICDGKSDCSGG 72 Query: 272 ----NCDKLXKPRKVLPILKTDEPICPEXKLACGSGD-CIEKELFCNGKPDCKDESDENA 436 NC K P P+ +P C + C +G C+++ C+G DC D SDE Sbjct: 73 EDEKNCVKPQTPPPTPPL----KPKCRISQRRCDNGSGCVDRMKICDGMRDCADGSDERG 128 Query: 437 C 439 C Sbjct: 129 C 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +2 Query: 332 ICPEXKLACG-SGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDP 481 +C + + CG S CI K C+GK DC DE C P P P Sbjct: 42 VCRDDQFQCGTSRKCIRKSKICDGKSDCSGGEDEKNCVKPQTPPPTPPLKP 92 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 2/79 (2%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPN-XCVLPDCFC 511 C + C +G CI + C+ + DC D SDE C+ ++ + C + C+ C Sbjct: 4 CSATEFRCNNGRCITRAFRCDDEDDCLDNSDEQGCSRKVCRDDQFQCGTSRKCIRKSKIC 63 Query: 512 SADGTRIPGGIEPNQV-PQ 565 G E N V PQ Sbjct: 64 DGKSDCSGGEDEKNCVKPQ 82 >SB_27746| Best HMM Match : MAM (HMM E-Value=1.4013e-45) Length = 622 Score = 42.3 bits (95), Expect = 4e-04 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 CP C SG+CI CN + DC D +DE C Sbjct: 219 CPSNMFLCPSGECIPTTALCNNENDCSDNADERNC 253 Score = 41.9 bits (94), Expect = 5e-04 Identities = 18/60 (30%), Positives = 28/60 (46%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCS 514 C E + C +G C+++ L C+G C D SDE C+ P+ C C+ C+ Sbjct: 183 CLEDEFGCENGQCVKRGLLCDGDKACLDGSDEKHCSC---PSNMFLCPSGECIPTTALCN 239 >SB_20531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 41.5 bits (93), Expect = 7e-04 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDE 430 C E + C SGDC+ C+G DC D SDE Sbjct: 216 CSEEEFPCASGDCVPLTSVCDGSADCSDSSDE 247 >SB_43823| Best HMM Match : MAM (HMM E-Value=0) Length = 1724 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 6/58 (10%) Frame = +2 Query: 320 TDEPICPEX-----KLACG-SGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDC 475 +DE CP ++ C S C+ + L C+GKPDC D SDE C V NR C Sbjct: 1333 SDEDDCPNSDCNLEQIYCPVSQKCLNRTLQCDGKPDCSDYSDEAHCRVRKSINRNVVC 1390 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +2 Query: 335 CPEXKLAC-GSGDCIEKELFCNGKPDCKDESDENAC 439 C + + C S CI+ C+G PDC D SDE+ C Sbjct: 1303 CNDDQFQCRASKICIKSSFVCDGVPDCNDHSDEDDC 1338 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +2 Query: 335 CPEXKLACGSGD-CIEKELFCNGKPDCKDESDENAC-------TVELDPNRAPDCD 478 C + C D CI C+G+ DC D DE C T L P DC+ Sbjct: 338 CQSNEFYCSKDDRCINIFWKCDGESDCTDGEDEQGCATTAPVITPSLGPPHPGDCN 393 Score = 29.5 bits (63), Expect = 2.9 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 335 CPEXKLAC-GSGDCIEKELFCNGKPDCKDESDEN 433 C ++ C SG C++++ C+ DC D +DE+ Sbjct: 120 CTANEVRCKNSGHCVQQQQVCDFTDDCGDGTDED 153 >SB_13477| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 628 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/74 (29%), Positives = 29/74 (39%), Gaps = 1/74 (1%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDE-NACTVELDPNRAPDCDPNXCVLPDCFC 511 CP + C +G CI C+G DC D SDE +C+ + C C+ C Sbjct: 10 CPSNRFRCNNGRCIPMSWRCDGDNDCGDMSDEPPSCSGRSCNSGQFSCSNGRCISRSWVC 69 Query: 512 SADGTRIPGGIEPN 553 D G E N Sbjct: 70 DRDNDCGDGSDERN 83 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDP 457 C + +C +G C+ L C+G DC D SDE +C P Sbjct: 103 CRSWEFSCLNGRCVFYRLVCDGVDDCGDSSDEMSCNATATP 143 Score = 35.9 bits (79), Expect = 0.033 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACT 442 C + +C +G CI + C+ DC D SDE C+ Sbjct: 50 CNSGQFSCSNGRCISRSWVCDRDNDCGDGSDERNCS 85 Score = 35.1 bits (77), Expect = 0.058 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAP 469 C + C + C+ C+G+ DC D SDE C+ P P Sbjct: 149 CHYWEFQCANRRCVYNSQRCDGQNDCGDWSDETGCSTPPIPTTCP 193 Score = 31.9 bits (69), Expect = 0.54 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +2 Query: 335 CPEXKLAC---GSGDCIEKELFCNGKPDCKDESDE 430 CP + C SG CI CNG+ DC D DE Sbjct: 192 CPADWVRCFYNSSGLCISTSWLCNGRVDCPDAWDE 226 Score = 29.5 bits (63), Expect = 2.9 Identities = 26/105 (24%), Positives = 46/105 (43%), Gaps = 2/105 (1%) Frame = +2 Query: 143 LTTEXDCRDVVRCTRSGLKQ-ITCPSGLAFDLDKQTCDWKGKVNNCDKLXKPRKVLPILK 319 ++T C V C + +Q C SG+ + TC +G V N + ++ + + Sbjct: 208 ISTSWLCNGRVDCPDAWDEQPAQCRSGIRYMSVDPTCVKRGFVRNTSAI-----MVRVFR 262 Query: 320 TDEPICPEXKLACGSGDCIEKELF-CNGKPDCKDESDENACTVEL 451 + E A D + ++ C+G DCKD +DE C++ L Sbjct: 263 PGTSVMGESSAAM---DLMRPDVQRCDGSYDCKDYTDEFNCSMPL 304 >SB_5319| Best HMM Match : Ldl_recept_a (HMM E-Value=7.56701e-44) Length = 212 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +2 Query: 335 CPEXKLACGSG-DCIEKELFCNGKPDCKDESDENACTVELDPNRAPDC-DPNXCVLPDCF 508 C + AC +G CI+++ C+G+ DC D SDE C +E N C + + C+ Sbjct: 114 CKPFEFACANGRHCIQRKWICDGENDCGDRSDEVDCGLESCGNDRWRCSNTSRCIAKSQV 173 Query: 509 C 511 C Sbjct: 174 C 174 Score = 31.1 bits (67), Expect = 0.95 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +2 Query: 335 CPEXKLACG-SGDCIEKELFCNGKPDCKDESDENACT 442 C + C S CI C+ DC D SDE CT Sbjct: 74 CHSTEFQCETSSRCIPLRFVCDADDDCGDRSDERNCT 110 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 335 CPEXKLACGSGD-CIEKELFCNGKPDCKDESDE 430 C + C + CI K C+G+ DC D SDE Sbjct: 154 CGNDRWRCSNTSRCIAKSQVCDGRVDCPDASDE 186 >SB_18178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 489 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +2 Query: 371 CIEKELFCNGKPDCKDESDENACTVELDPNR 463 CI+ C+GKP+C D SDEN C ++P+R Sbjct: 285 CIDISYKCDGKPECADHSDENDCPPLINPDR 315 Score = 39.1 bits (87), Expect = 0.004 Identities = 31/108 (28%), Positives = 43/108 (39%) Frame = +2 Query: 110 CDGRPADEYFRLTTEXDCRDVVRCTRSGLKQITCPSGLAFDLDKQTCDWKGKVNNCDKLX 289 CDG+P E + E DC ++ R + I P + G N C L Sbjct: 292 CDGKP--ECADHSDENDCPPLINPDRCNVIHIYQPRNKKHPFVWKLSRKCGYTNRCT-LN 348 Query: 290 KPRKVLPILKTDEPICPEXKLACGSGDCIEKELFCNGKPDCKDESDEN 433 ++ + D P C SG CI + C+GK DC D SDE+ Sbjct: 349 TTQE-----ERDAPCKISSWFKCRSGVCIPPQWICDGKDDCGDRSDES 391 >SB_51630| Best HMM Match : Fz (HMM E-Value=3.3e-34) Length = 1120 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACT 442 C + C S +CI L C+G DC D SDE CT Sbjct: 23 CDPGQFECTSSECIPDVLKCDGSEDCADSSDEINCT 58 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +2 Query: 320 TDEPICPEXKLACG-SGDCIEKELFCNGKPDCKDESDENAC 439 T +C + C GDCI C+G DC+ +DE C Sbjct: 58 TKRSMCRVDQFECLIEGDCIPLSKHCDGTWDCQHGTDEMDC 98 >SB_6273| Best HMM Match : MAM (HMM E-Value=0) Length = 4272 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 329 PICPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 P+C + C G CI+ C+ DC D SDEN C Sbjct: 2091 PMCQYGQFRCARGSCIDTGRVCDFTDDCGDNSDENNC 2127 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +2 Query: 308 PILKTDEPICPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 P T P C + C +G CI C+ K DC D SDE C Sbjct: 2541 PPTSTPPPGCNSGEHRCSNGQCINAIQVCDFKKDCSDGSDEATC 2584 Score = 36.7 bits (81), Expect = 0.019 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 329 PICPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 P CP C G CI + L C+ + DC D DE +C Sbjct: 2244 PPCPFGLFRCTDGSCIMQSLRCDYQNDCSDGLDEASC 2280 Score = 35.9 bits (79), Expect = 0.033 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 356 CGSGDCIEKELFCNGKPDCKDESDENACTV 445 C +G CI+K C+ DC D SDE C + Sbjct: 3211 CTNGGCIQKSKLCDFTDDCGDNSDEGRCAL 3240 Score = 35.9 bits (79), Expect = 0.033 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 332 ICPEXKLACGSGDCIEKELFCNGKPDCKDESDENACT 442 +C + C G C + C+ DC D SDE +C+ Sbjct: 3619 VCTRSQFRCTRGSCTSSDNVCDFSDDCGDSSDERSCS 3655 Score = 32.3 bits (70), Expect = 0.41 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDC--KDESDENAC 439 C + C G CI K C+ + DC D SDE+ C Sbjct: 4059 CNTDEFKCSRGGCIPKSYLCDYQADCMFNDLSDESKC 4095 Score = 31.5 bits (68), Expect = 0.72 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACT 442 C + C SG CI C+ + DC D S+E T Sbjct: 2783 CSSNQFRCDSGHCISSSSKCDFETDCCDGSEERNST 2818 Score = 28.3 bits (60), Expect = 6.7 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 335 CPEXKLACGS-GDCIEKELFCNGKPDCKDESDENAC 439 C + C + G CI C+ DC D SDE +C Sbjct: 3425 CNAQQFGCVTDGKCIPLTSVCDFNVDCLDGSDERSC 3460 >SB_19614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +2 Query: 314 LKTDEPICPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVE 448 L + E C K C + CI+ CN + DC+D SDE +C E Sbjct: 385 LVSSEGPCGPKKFTCQNRQCIDDFKQCNNRQDCRDGSDEISCPPE 429 >SB_51898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1712 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = +2 Query: 323 DEPICPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCV 493 D P C E + C +G CI+ + C+ +C D SDE C +PN C+ C+ Sbjct: 1342 DCPPCKENQFRCDNGQCIDGDPRCDKYKNCTDGSDELGCAT-CEPNFF-RCNTGKCI 1396 Score = 33.1 bits (72), Expect = 0.23 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = +2 Query: 335 CPEXKLACGS--GDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCF 508 C ++C S CI K C+G DC D+SDE C N+ CD C+ D Sbjct: 1307 CKPNYISCASMKAICIPKMWRCDGMLDCTDKSDEEDCP-PCKENQF-RCDNGQCIDGDPR 1364 Query: 509 C 511 C Sbjct: 1365 C 1365 Score = 31.9 bits (69), Expect = 0.54 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C C +G CI C+ DC D SDE C Sbjct: 1383 CEPNFFRCNTGKCISARWQCDQLDDCGDNSDEIGC 1417 >SB_45605| Best HMM Match : MAM (HMM E-Value=2.1e-16) Length = 187 Score = 37.9 bits (84), Expect = 0.008 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C + C++++ CN K DC D SDE C Sbjct: 145 CLASQYVCANSKCVDRDQLCNFKDDCGDNSDELPC 179 >SB_50657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C C +G CI L C+ DC DESDE C Sbjct: 5 CKAGDFRCANGRCISGALVCDLDDDCGDESDERGC 39 >SB_18810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +2 Query: 335 CPEXKLAC-GSGDCIEKELFCNGKPDCKDESDENAC 439 C + + C S CI+ C+G PDC D SDE+ C Sbjct: 6 CNDDQFQCRASKICIKSSFVCDGVPDCNDHSDEDDC 41 Score = 37.5 bits (83), Expect = 0.011 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 6/49 (12%) Frame = +2 Query: 320 TDEPICPEX-----KLACG-SGDCIEKELFCNGKPDCKDESDENACTVE 448 +DE CP ++ C S C+ + L C+GKPDC D SDE C E Sbjct: 36 SDEDDCPNSDCNLEQIYCPVSQKCLNRTLQCDGKPDCSDYSDEAHCRGE 84 >SB_35350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 626 Score = 37.1 bits (82), Expect = 0.014 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDE 430 C + C +G+CI K C+G+ DC ++SDE Sbjct: 592 CKSSEYQCSTGECIHKSWVCDGEFDCLNKSDE 623 Score = 32.3 bits (70), Expect = 0.41 Identities = 16/64 (25%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC--TVELDPNRAPDCDPNXCVLPDCF 508 C + C CI C+G DC D SDE C + + + C C+ Sbjct: 551 CRPNEFTCADKRCILSRWRCDGDRDCADNSDEINCPNSSQYCKSSEYQCSTGECIHKSWV 610 Query: 509 CSAD 520 C + Sbjct: 611 CDGE 614 >SB_23898| Best HMM Match : Ldl_recept_a (HMM E-Value=1.4013e-45) Length = 291 Score = 37.1 bits (82), Expect = 0.014 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACT 442 C + C +G+CI + C+ DC D SDE AC+ Sbjct: 134 CGSTQFRCRNGNCINRNYVCDKDNDCGDGSDEVACS 169 Score = 36.7 bits (81), Expect = 0.019 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 332 ICPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 +C + K C +G C+ + C+G DC+D +DE C Sbjct: 98 VCSQFK--CNNGHCVHRNWKCDGSNDCRDGTDEVGC 131 Score = 35.5 bits (78), Expect = 0.044 Identities = 27/97 (27%), Positives = 39/97 (40%), Gaps = 3/97 (3%) Frame = +2 Query: 158 DCRD---VVRCTRSGLKQITCPSGLAFDLDKQTCDWKGKVNNCDKLXKPRKVLPILKTDE 328 DCRD V C + G Q C +G + + CD K N+C + + + Sbjct: 121 DCRDGTDEVGCGKCGSTQFRCRNGNCINRN-YVCD---KDNDCGD---GSDEVACSRLNG 173 Query: 329 PICPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C + CI C+ DC D SDE+ C Sbjct: 174 GWCGAGQYRCDNDRCIPLNWVCDRLNDCHDNSDESGC 210 >SB_31087| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-32) Length = 1039 Score = 36.7 bits (81), Expect = 0.019 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = +2 Query: 266 VNNCDKLXKPRKVLPILKTDEPI-CPEXKLACGSG-DCIEKELFCNGKPDCKDESDENAC 439 V++CD K PI + DE C K C +G C+ C+ DC D DE+ C Sbjct: 924 VHDCDD-GSDEKNCPISRRDEEFGCGSDKFTCDNGAKCLPLTWLCDSITDCMDSKDEHNC 982 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 335 CPEXKLACG-SGDCIEKELFCNGKPDCKDESDENACTV 445 C E + AC + C+ K C+ DC D SDE C + Sbjct: 901 CAEGQFACEKTNKCLAKSSLCDTVHDCDDGSDEKNCPI 938 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 335 CPEXKLACGSGD-CIEKELFCNGKPDCKDESDENAC 439 C + C +G CI + C+ DC D+ DE C Sbjct: 836 CAADRYRCDNGKKCIPLKWICDSVADCDDKRDERNC 871 >SB_2014| Best HMM Match : MAM (HMM E-Value=0) Length = 2282 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C SG CI C+G +C D SDE+ C Sbjct: 209 CAPYEFQCTSGHCISGSSRCDGDYNCMDRSDEDGC 243 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C +L C SG C++ C+G DC+ DE C Sbjct: 245 CFTNELTCSSGRCVQSINLCDGVRDCEYGLDELRC 279 >SB_13199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 36.3 bits (80), Expect = 0.025 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 CP + C + C+ + C+G DC D SDE C Sbjct: 21 CPRHEFECENKLCVPRTWLCDGDNDCHDGSDEKNC 55 Score = 33.9 bits (74), Expect = 0.13 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDEN 433 C + CG+ CI + C+G DC D SDE+ Sbjct: 65 CGIEEFDCGNSTCIPLTVLCDGLYDCADRSDES 97 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/54 (29%), Positives = 19/54 (35%) Frame = +2 Query: 392 CNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCSADGTRIPGGIEPN 553 C+G DC D DE P +C+ CV C D G E N Sbjct: 2 CDGTVDCPDALDE-IVNCSRCPRHEFECENKLCVPRTWLCDGDNDCHDGSDEKN 54 >SB_58974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1831 Score = 35.5 bits (78), Expect = 0.044 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 209 CPSGLAFDLDKQTCDWKGKVNNCDKLXK-PRKVLPILKTDEPIC 337 CP+GL + + K CDW V +CD+ P P+ T +P C Sbjct: 1269 CPAGLKWSVKKTACDWPRYV-DCDRTTSTPPTPTPLTPTTKPAC 1311 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +2 Query: 209 CPSGLAFDLDKQTCDWKGKVNNCD-KLXKPRKVLPILKTDEPIC 337 C GL + + K TCDW V +CD K P P T +P C Sbjct: 814 CSPGLKWSITKTTCDWPRNV-DCDRKTPTPPSPTPPTTTPKPAC 856 Score = 31.5 bits (68), Expect = 0.72 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 209 CPSGLAFDLDKQTCDWKGKVNNCDK 283 CP+GL + + K TCDW V +CD+ Sbjct: 1024 CPAGLKWSVKKTTCDWPRYV-DCDR 1047 Score = 29.9 bits (64), Expect = 2.2 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +2 Query: 110 CDGRPADEYFRLTTEXDCRDVVRCTRSGLKQI-TCPSGLAFDLDKQTCDWKGKVNNCDK 283 C +P Y DC +C + CP+GL + + K CDW V +CD+ Sbjct: 888 CKDKPNGHY---ADPRDCSKFYQCDAFHRAFLHRCPAGLKWSVKKTACDWPRYV-DCDR 942 Score = 29.5 bits (63), Expect = 2.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 209 CPSGLAFDLDKQTCDWKGKVNNCDK 283 CP+GL + + K CDW V +CD+ Sbjct: 1169 CPAGLKWSVKKTACDWPRYV-DCDR 1192 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 35.1 bits (77), Expect = 0.058 Identities = 16/60 (26%), Positives = 24/60 (40%) Frame = +2 Query: 92 PNADQLCDGRPADEYFRLTTEXDCRDVVRCTRSGLKQITCPSGLAFDLDKQTCDWKGKVN 271 P C+ + +Y +C + C+ + CP L FD K C+W KVN Sbjct: 591 PPKSPFCEEKKNGDY---ADPSNCNGFITCSNGYAYKRDCPFNLKFDTKKLECEWPNKVN 647 Score = 32.7 bits (71), Expect = 0.31 Identities = 23/91 (25%), Positives = 36/91 (39%), Gaps = 4/91 (4%) Frame = +2 Query: 158 DCRDVVRCTRSGLKQITCPSGLAFDLDKQTCDWKGKVNNCDK--LXKPRKVLPILKTDEP 331 +C V C+ + + CPS L +D K C+W V +C + P P +P Sbjct: 531 NCNGFVMCSNGYIYYMDCPSNLRYDPAKGRCEWADTV-DCGQRPTISPHPPKPTTMPPQP 589 Query: 332 ICPEXKLA--CGSGDCIEKELFCNGKPDCKD 418 P+ +GD + CNG C + Sbjct: 590 TPPKSPFCEEKKNGDYADPS-NCNGFITCSN 619 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = +2 Query: 110 CDGRPADEYFRLTTEXDCRDVVRCTRSGLKQITCPSGLAFDLDKQTCDW 256 C+GR +Y +C ++C+ CPS L F++ K DW Sbjct: 731 CEGRKDGDY---VDAVNCNGFIKCSNQLTYYFDCPSNLRFNIKK---DW 773 >SB_28040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 35.1 bits (77), Expect = 0.058 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C SG CI C+ +C D SDE+ C Sbjct: 231 CASYEFQCASGHCISGSSRCDSDYNCMDRSDEDGC 265 Score = 34.3 bits (75), Expect = 0.10 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C +L C SG C+ C+G DC+ + DE C Sbjct: 267 CFTNELTCSSGRCVPSINLCDGVKDCEQDLDELRC 301 >SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) Length = 1217 Score = 35.1 bits (77), Expect = 0.058 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C SG CI C+ +C D SDE+ C Sbjct: 1104 CASYEFQCASGHCISGSSRCDSDYNCMDRSDEDGC 1138 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C +L C SG C+ C+G DC+ DE C Sbjct: 1140 CFTNELTCSSGRCVPSINLCDGVKDCEHGLDELRC 1174 >SB_8478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 35.1 bits (77), Expect = 0.058 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C SG CI C+ +C D SDE+ C Sbjct: 194 CASYEFQCASGHCISGSSRCDSDYNCMDRSDEDGC 228 Score = 34.7 bits (76), Expect = 0.077 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVELDPNRAPDC 475 C +L C SG C+ C+G DC+ DE C + P + +C Sbjct: 230 CFTNELTCSSGRCVPSINLCDGVKDCEHGLDELRCGSSVCPLNSLNC 276 >SB_31927| Best HMM Match : Ldl_recept_a (HMM E-Value=2.3e-27) Length = 157 Score = 34.7 bits (76), Expect = 0.077 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 356 CGSGDCIEKELFCNGKPDCKDESDENACT 442 C +G+CI + C+ DC D SDE AC+ Sbjct: 7 CRNGNCINRNYVCDKDNDCGDGSDEVACS 35 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C + CI C+ DC D SDE+ C Sbjct: 42 CGAGQYRCDNDRCIPLNWVCDRLNDCHDNSDESGC 76 >SB_43556| Best HMM Match : Ldl_recept_a (HMM E-Value=2.7e-11) Length = 65 Score = 34.3 bits (75), Expect = 0.10 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 338 PEXKLACGSGDCIEKELFCNGKPDCKDESDENACT 442 P+ C +G CI C+ + DC D SDE C+ Sbjct: 8 PDTSFKCDNGRCISATWVCDTENDCGDNSDEMNCS 42 >SB_22727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 34.3 bits (75), Expect = 0.10 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C SG CI C+ +C D SDE+ C Sbjct: 275 CASYEFQCTSGHCISGSSRCDSDYNCMDSSDEDGC 309 Score = 32.7 bits (71), Expect = 0.31 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C +L C SG C+ C+G DC+ DE C Sbjct: 311 CFTNELTCSSGRCVPSINLCDGVKDCEQGLDELRC 345 >SB_43832| Best HMM Match : CBM_14 (HMM E-Value=2.8e-16) Length = 518 Score = 33.9 bits (74), Expect = 0.13 Identities = 19/65 (29%), Positives = 27/65 (41%) Frame = +2 Query: 74 DGAGDEPNADQLCDGRPADEYFRLTTEXDCRDVVRCTRSGLKQITCPSGLAFDLDKQTCD 253 +G N D + R D + + +C V C + TCP GL F+ D CD Sbjct: 445 EGTPKYSNKDGMFCERNGDGIY--AEKENCYGFVLCGGGIAHKKTCPPGLIFNTDLMVCD 502 Query: 254 WKGKV 268 W +V Sbjct: 503 WSHEV 507 >SB_40871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 33.5 bits (73), Expect = 0.18 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 356 CGSGDCIEKELFCNGKPDCKDESDENAC 439 C +G I + C+G+ DC+D SDE C Sbjct: 88 CSNGHLIYRHWRCDGENDCRDGSDETGC 115 Score = 33.1 bits (72), Expect = 0.23 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 Query: 335 CPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 C + C +G C+ + C+ DC D SDE C Sbjct: 118 CSSSQFRCRNGRCVSRSWVCDKDNDCGDGSDEVQC 152 Score = 32.7 bits (71), Expect = 0.31 Identities = 27/105 (25%), Positives = 37/105 (35%), Gaps = 3/105 (2%) Frame = +2 Query: 134 YFRLTTEXDCRD---VVRCTRSGLKQITCPSGLAFDLDKQTCDWKGKVNNCDKLXKPRKV 304 ++R E DCRD C Q C +G CD K N+C Sbjct: 97 HWRCDGENDCRDGSDETGCGSCSSSQFRCRNGRCVSRS-WVCD---KDNDCGD---GSDE 149 Query: 305 LPILKTDEPICPEXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 + + C + C + CI + C+ DC D SDE C Sbjct: 150 VQCNRAGGGWCGAGRYRCDNDRCIPRNWVCDRDNDCGDGSDETGC 194 >SB_13694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/57 (28%), Positives = 22/57 (38%) Frame = +2 Query: 101 DQLCDGRPADEYFRLTTEXDCRDVVRCTRSGLKQITCPSGLAFDLDKQTCDWKGKVN 271 D C +P EY CR + C CP GL ++ + CDW V+ Sbjct: 73 DDFCKYKPDGEY--RDPYDACRGFIHCHNYNASYKPCPGGLLYNEKTKQCDWPRNVD 127 >SB_33423| Best HMM Match : Ldl_recept_a (HMM E-Value=7.8e-22) Length = 133 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 335 CPEXKLACG-SGDCIEKELFCNGKPDCKDESDENACTV 445 C E + AC + C+ K C+ DC D SDE C + Sbjct: 88 CAEGQFACEKTNKCLAKSSLCDTVHDCDDGSDEKNCPI 125 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 335 CPEXKLACGSGD-CIEKELFCNGKPDCKDESDENAC 439 C + C +G CI + C+ DC D+ DE C Sbjct: 23 CAADRYRCDNGKKCIPLKWICDSVADCDDKRDERNC 58 >SB_3253| Best HMM Match : Ldl_recept_a (HMM E-Value=0.00064) Length = 48 Score = 32.3 bits (70), Expect = 0.41 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 6/42 (14%) Frame = +2 Query: 332 ICPEXKLACGSG-----DCIEKELFCNGKPDCKDES-DENAC 439 +CP CG+G CI K L CNG DC DE+ C Sbjct: 6 LCPSGYFYCGTGPKGEISCINKALRCNGIYDCSVTGWDEDGC 47 >SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) Length = 339 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 206 TCPSGLAFDLDKQTCDWKGKVNNCD 280 +CPSGL + + K TCDW V +CD Sbjct: 145 SCPSGLKWSVTKTTCDWPRYV-DCD 168 >SB_27119| Best HMM Match : CBM_14 (HMM E-Value=4.1e-15) Length = 220 Score = 32.3 bits (70), Expect = 0.41 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +2 Query: 206 TCPSGLAFDLDKQTCDWKGKVNNCD 280 +CPSGL + + K TCDW V +CD Sbjct: 52 SCPSGLKWSVTKTTCDWPRYV-DCD 75 >SB_58073| Best HMM Match : CBM_14 (HMM E-Value=1.4e-17) Length = 225 Score = 31.9 bits (69), Expect = 0.54 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +2 Query: 161 CRDVVRCTRSGLKQITCPSGLAFDLDKQTCDW 256 C+ + C+ ++ CP+GL ++ +K+ CDW Sbjct: 100 CKMYIACSNGIAYEMPCPAGLNWNDEKKYCDW 131 >SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 675 Score = 31.9 bits (69), Expect = 0.54 Identities = 32/127 (25%), Positives = 51/127 (40%), Gaps = 6/127 (4%) Frame = +2 Query: 128 DEYFRLTTEXDCRDVVRCTRSGLK-QITCPSGLAFDLDKQTCDWKGKVNNCDKLXKPRKV 304 D + R + +C ++ +C L +TC G + + C NNCD KP + Sbjct: 100 DPFKRPPEQREC-ELQKCEELALHCSVTC--GFGYKRREVYCS----TNNCDTARKPTQ- 151 Query: 305 LPILKTDEPICPEXKLACGSGDCIEKELFCNG-----KPDCKDESDENACTVELDPNRAP 469 +LK + P+CP+ +GD + L C G + DC S C P + Sbjct: 152 --LLKCELPVCPQW----NAGDWGQCSLTCGGGVQTRRIDC--SSSLTKCDHRKKPVESR 203 Query: 470 DCDPNXC 490 C+ C Sbjct: 204 RCNTEAC 210 >SB_4518| Best HMM Match : CBM_14 (HMM E-Value=0.019) Length = 86 Score = 31.9 bits (69), Expect = 0.54 Identities = 16/52 (30%), Positives = 22/52 (42%) Frame = +2 Query: 98 ADQLCDGRPADEYFRLTTEXDCRDVVRCTRSGLKQITCPSGLAFDLDKQTCD 253 A Q C RP Y + R + C++ K + CP G FD + CD Sbjct: 38 AYQYCATRPDGRY---PAQPSTRGFIVCSKGMTKHVDCPQGQTFDSNLLICD 86 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 31.1 bits (67), Expect = 0.95 Identities = 20/76 (26%), Positives = 31/76 (40%) Frame = +2 Query: 101 DQLCDGRPADEYFRLTTEXDCRDVVRCTRSGLKQITCPSGLAFDLDKQTCDWKGKVNNCD 280 ++ C G+ Y DC +C + + CP GL F+ ++CD KVN Sbjct: 225 EKFCAGKTDGTY---ADPKDCSAYYQCKKGRSFKKFCPDGLKFNALIKSCDEPSKVNCVT 281 Query: 281 KLXKPRKVLPILKTDE 328 K + +K DE Sbjct: 282 KQRDEEEEEEKVKDDE 297 >SB_26126| Best HMM Match : Ldl_recept_b (HMM E-Value=3e-24) Length = 652 Score = 31.1 bits (67), Expect = 0.95 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 329 PICPEXKLACGS-GDCIEKELFCNGKPDCKDESDE 430 P C + C S G CI + C+G DC+D DE Sbjct: 209 PPCMPGEFKCQSTGRCIPESKVCDGTRDCQDGEDE 243 >SB_16363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 31.1 bits (67), Expect = 0.95 Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +2 Query: 311 ILKTDEPICPEXKLACGSGDCIEKELFCNGKPDCKDESDENACTVEL-DPNRAPDCDP 481 + + D +C + + C G+C + +C+ +D + CTV +P + C P Sbjct: 521 VYQPDNTVCDKGRRVCSVGECAKSICTKYALEECQCTADNDLCTVCCKEPGKDDTCTP 578 >SB_31319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1186 Score = 30.3 bits (65), Expect = 1.7 Identities = 24/95 (25%), Positives = 39/95 (41%), Gaps = 8/95 (8%) Frame = +2 Query: 230 DLDKQTCDWKGKVNNCDKLXKPRKVLPILKTDEPICPEXK--------LACGSGDCIEKE 385 D+D + D K ++NNC + +P+ P P E K + CG+G IE Sbjct: 651 DVDGRQVDRKVEINNCPQWSRPKVTRPCQLPPCPPPNEWKTGPWRQCSVTCGTG--IETR 708 Query: 386 LFCNGKPDCKDESDENACTVELDPNRAPDCDPNXC 490 + +E+AC + P+ C+P C Sbjct: 709 TVECMDVEQNITQEESACAEKPKPHTTRRCNPGGC 743 >SB_17635| Best HMM Match : CUB (HMM E-Value=0) Length = 630 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 Query: 341 EXKLACGSGDCIEKELFCNGKPDCKDESDENAC 439 E C + + I+ + C+G DC D SDE+ C Sbjct: 419 ELLFKCDNDNYIQCQWKCDGTDDCGDHSDEDNC 451 >SB_7335| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 2681 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 356 CGSGDCIEKELFCNGKPDCKDESDE-NACTVELDPNRAPDC 475 CG+G E+ C G +C +++ C V+ P PDC Sbjct: 2010 CGAGGKRERSRTCQGGSNCPGSANQVEMCDVQRCPLICPDC 2050 >SB_1784| Best HMM Match : CBM_14 (HMM E-Value=7e-18) Length = 123 Score = 29.1 bits (62), Expect = 3.8 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +2 Query: 158 DCRDVVRCTRSGLKQITCPSGLAFDLDKQTCDW 256 +C+ + C+ + CP+GL ++ K+ CDW Sbjct: 75 NCKMYITCSNKITYERQCPAGLNWNDAKKWCDW 107 >SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1680 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +2 Query: 356 CGSGDCIEKELFCNGKPDCKDESDE-NACTVELDPNRAPDC 475 CG+G E+ C G +C +++ C V+ P PDC Sbjct: 16 CGAGGKRERSRTCQGGSNCPGSANQVEMCDVQRCPLICPDC 56 >SB_11110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 862 Score = 28.3 bits (60), Expect = 6.7 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 269 NNCDKLXKPRKVLPILKTDEPICPEXKLACGSGDCI 376 NNCD L KP+ + L+TDE + + C S C+ Sbjct: 200 NNCDGLDKPKDLK--LRTDEDLLWILTIKCCSNKCM 233 >SB_38846| Best HMM Match : Cache (HMM E-Value=2.7e-09) Length = 916 Score = 27.9 bits (59), Expect = 8.8 Identities = 28/117 (23%), Positives = 41/117 (35%), Gaps = 2/117 (1%) Frame = +2 Query: 209 CPSGLAFDLDKQTCDWKGKVNNCDKLXKPRKVLPILKTDEPICPEXKLACGSGDCIEK-- 382 C + LD CD + ++N P + L + + P C C EK Sbjct: 699 CQCPCSSTLDFNYCDSEYPLSNVSICAVPAEALLTSEEKQACVPRDLQKCYDPKCSEKTT 758 Query: 383 ELFCNGKPDCKDESDENACTVELDPNRAPDCDPNXCVLPDCFCSADGTRIPGGIEPN 553 E C G C + C D + A +P + +CF G + PG E N Sbjct: 759 EGACEGVVGC------SWCV--RDGDGASLSNPFCSPIDECFAGTKGAKSPGAGEGN 807 >SB_5369| Best HMM Match : wnt (HMM E-Value=2.9e-18) Length = 354 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 65 KHDDGAGDEPNADQLCDGRPADEYFRLTTEXDCRDV-VRCTR 187 K D + +E N D +C GR D + +T CR+V VR +R Sbjct: 63 KISDDSQEEENCDVMCCGRGYDTHL-ITKRWQCRNVLVRWSR 103 >SB_26236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.9 bits (59), Expect = 8.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 416 DESDENACTVELDPNRAPDCDPNXCV 493 D+ D+ C +P++ PD D + CV Sbjct: 410 DQGDQGECVTVPEPDQVPDSDRDECV 435 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,367,088 Number of Sequences: 59808 Number of extensions: 457414 Number of successful extensions: 1489 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 1259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1473 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1925890720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -