BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0090 (413 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY341209-1|AAR13773.1| 196|Anopheles gambiae SP14D1 protein. 23 3.3 AY341208-1|AAR13772.1| 196|Anopheles gambiae SP14D1 protein. 23 3.3 AY341207-1|AAR13771.1| 196|Anopheles gambiae SP14D1 protein. 23 3.3 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 3.3 AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. 23 4.4 >AY341209-1|AAR13773.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 23.4 bits (48), Expect = 3.3 Identities = 10/46 (21%), Positives = 22/46 (47%) Frame = -2 Query: 211 IDLHLLVIHNVNTCXSFSYNTDLGQFRSNSTSNFSNPKHLLILSLA 74 +D+ +++H S++ D+ R N N+S+ + L L+ Sbjct: 28 LDIEKIIVHPGYNLQDKSHHNDIALIRFNREINYSSTIRAICLPLS 73 >AY341208-1|AAR13772.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 23.4 bits (48), Expect = 3.3 Identities = 10/46 (21%), Positives = 22/46 (47%) Frame = -2 Query: 211 IDLHLLVIHNVNTCXSFSYNTDLGQFRSNSTSNFSNPKHLLILSLA 74 +D+ +++H S++ D+ R N N+S+ + L L+ Sbjct: 28 LDIEKIIVHPGYNLQDKSHHNDIALIRFNREINYSSTIRAICLPLS 73 >AY341207-1|AAR13771.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 23.4 bits (48), Expect = 3.3 Identities = 10/46 (21%), Positives = 22/46 (47%) Frame = -2 Query: 211 IDLHLLVIHNVNTCXSFSYNTDLGQFRSNSTSNFSNPKHLLILSLA 74 +D+ +++H S++ D+ R N N+S+ + L L+ Sbjct: 28 LDIEKIIVHPGYNLQDKSHHNDIALIRFNREINYSSTIRAICLPLS 73 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 23.4 bits (48), Expect = 3.3 Identities = 10/46 (21%), Positives = 22/46 (47%) Frame = -2 Query: 211 IDLHLLVIHNVNTCXSFSYNTDLGQFRSNSTSNFSNPKHLLILSLA 74 +D+ +++H S++ D+ R N N+S+ + L L+ Sbjct: 192 LDIEKIIVHPGYNLQDKSHHNDIALIRFNREINYSSTIRAICLPLS 237 >AY341206-1|AAR13770.1| 196|Anopheles gambiae SP14D1 protein. Length = 196 Score = 23.0 bits (47), Expect = 4.4 Identities = 10/46 (21%), Positives = 22/46 (47%) Frame = -2 Query: 211 IDLHLLVIHNVNTCXSFSYNTDLGQFRSNSTSNFSNPKHLLILSLA 74 +D+ +++H S++ D+ R N N+S+ + L L+ Sbjct: 28 LDIEKIIVHPGYNLQDKSHHNDIALIRFNREINYSSTISAICLPLS 73 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 266,296 Number of Sequences: 2352 Number of extensions: 3677 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 33777477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -