BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0088 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 4.4 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 7.6 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/41 (26%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 182 FSPNGETLISCSEDDQIVIYDCEKGTQMI-TVNSKKYGVDL 301 +SP G+ + SED Q+V + T + +VN+++ +++ Sbjct: 1505 YSPTGKRVALLSEDGQVVDFAMHSKTAFVASVNARQCLIEM 1545 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 7.6 Identities = 13/53 (24%), Positives = 22/53 (41%) Frame = -3 Query: 169 NFVCIFTEYFGNFKASDNLINEFHHFYAYNRCFCSLIFTLNKLQRQPNITIKL 11 +F+ E G+F ++ H F+ R F L +L+R I+L Sbjct: 1232 SFINKLCERVGSFTKLKRIVAYCHRFFDRKRIHRKSYFELRELKRAEKTIIRL 1284 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 828,862 Number of Sequences: 2352 Number of extensions: 17706 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -