BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0087 (749 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identica... 192 3e-49 At5g19130.2 68418.m02277 GPI transamidase component family prote... 29 4.4 At5g19130.1 68418.m02276 GPI transamidase component family prote... 29 4.4 At2g06090.1 68415.m00668 self-incompatibility protein-related si... 29 4.4 >At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identical to cytochrome c oxidase subunit 3 (GI:15215914) [Arabidopsis thaliana]; similar to Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Swiss-Prot:P92514) [Arabidopsis thaliana] Length = 265 Score = 192 bits (467), Expect = 3e-49 Identities = 99/199 (49%), Positives = 119/199 (59%) Frame = +1 Query: 115 RDISREGTYQGKHTILVNKGLR*GXXXXXXXXXXXXXXXXXXXXHRRLSPNIEIGRI*PP 294 RD+ RE T +G HT +V G R G H L+P +EIG I PP Sbjct: 62 RDVLRESTLEGHHTKVVQLGPRYGSILFIVSEVMFFFAFFWASSHSSLAPAVEIGGIWPP 121 Query: 295 SRITPFNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRLFLTILLGFYFTILQA 474 I +P++IP LNT IL SG VT AHH+++ + L T+LL FT Q Sbjct: 122 KGIEVLDPWEIPFLNTPILPSSGAAVTWAHHAILAGKEKRAVYALVATVLLALVFTGFQG 181 Query: 475 YEYIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRHLNNHFSKNHHFGFEAA 654 EY +A FTI+D IYGSTFF+ATGFHG HVIIGTLFL+IC IR H +K HH GFEAA Sbjct: 182 MEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQYLGHLTKEHHVGFEAA 241 Query: 655 A*Y*HFVDVG*LFLYISIY 711 A Y HFVDV LFL++SIY Sbjct: 242 AWYWHFVDVVWLFLFVSIY 260 >At5g19130.2 68418.m02277 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 696 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 466 LQAYEYIEASFTIADRIYGSTFFIATGFHG 555 + A +Y+E S T+A +Y I TG HG Sbjct: 352 IPAADYLEGSATLASSLYSQALGIPTGPHG 381 >At5g19130.1 68418.m02276 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 699 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 466 LQAYEYIEASFTIADRIYGSTFFIATGFHG 555 + A +Y+E S T+A +Y I TG HG Sbjct: 355 IPAADYLEGSATLASSLYSQALGIPTGPHG 384 >At2g06090.1 68415.m00668 self-incompatibility protein-related similar to S1 self-incompatibility protein [Papaver rhoeas] GI:452430 Length = 135 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 445 LGFYFTILQAYEYIEASFTIADRIYGSTFFIATGFHGI 558 LG + T+ ++YEY +F D ++G T F T HG+ Sbjct: 53 LGIH-TVARSYEY---NFKFEDSVFGRTEFFCTLMHGV 86 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,498,521 Number of Sequences: 28952 Number of extensions: 167529 Number of successful extensions: 263 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 262 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -