BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0086 (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88175-5|AAB42278.2| 350|Caenorhabditis elegans Hypothetical pr... 82 3e-16 U80438-6|AAB37637.2| 663|Caenorhabditis elegans Hypothetical pr... 58 6e-09 U51999-3|AAA96084.1| 306|Caenorhabditis elegans Hypothetical pr... 29 2.4 Z68009-2|CAA92004.2| 891|Caenorhabditis elegans Hypothetical pr... 28 7.4 U28943-10|AAA68362.1| 329|Caenorhabditis elegans Dehydrogenases... 28 7.4 >U88175-5|AAB42278.2| 350|Caenorhabditis elegans Hypothetical protein F21F3.1 protein. Length = 350 Score = 82.2 bits (194), Expect = 3e-16 Identities = 46/127 (36%), Positives = 71/127 (55%) Frame = +1 Query: 79 DYFNYGANDDVLKNLESQLSKDEVVLRPQEVKDWPQQSLNVGQITAVSINSLGQPVIFHR 258 +YF YG D + +E V + +E+ S +GQ++ +++N G V FHR Sbjct: 23 EYF-YG---DEQQPIEEGAENSAVFEQDRELIGLFNPSKEIGQVSGLAVNKNGHIVAFHR 78 Query: 259 ADRVWDENTFNESNAYQNFDKGPIVEDTILVLDPGSGSVLHSWGAYIFYMPXGLTLDHHD 438 + RVWDE +FN+ + N D G I TI ++ V+ +GA +FYMP GLT+D++ Sbjct: 79 SGRVWDEKSFNDHETF-NKDLGVINNKTIAIIS-REKKVIDEFGAGLFYMPHGLTIDNNG 136 Query: 439 NVWVTDV 459 + WVTDV Sbjct: 137 DYWVTDV 143 >U80438-6|AAB37637.2| 663|Caenorhabditis elegans Hypothetical protein T19B4.1 protein. Length = 663 Score = 58.0 bits (134), Expect = 6e-09 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 2/91 (2%) Frame = +1 Query: 193 LNVGQITAVSINSLGQPVIFHRADRVWDENTFNESNAYQNFDKGPIVEDTILVLD-PGSG 369 + +GQ+ ++ N+ Q ++F RA RVWD +TF+ N DK PI + ILV+ G+ Sbjct: 355 VKLGQVAGLAFNNEQQLLVFQRAGRVWDASTFDNYNIL--LDKKPIADPVILVISYSGNQ 412 Query: 370 SVL-HSWGAYIFYMPXGLTLDHHDNVWVTDV 459 + L G FY+P G+ +D V+ TDV Sbjct: 413 TKLERKLGGGQFYLPHGIYVDKDGFVYTTDV 443 >U51999-3|AAA96084.1| 306|Caenorhabditis elegans Hypothetical protein C43H6.7 protein. Length = 306 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/53 (26%), Positives = 29/53 (54%) Frame = -2 Query: 375 NGAATRVKNKNCIFNYRSLVEVLISIGFVESIFVPYSICPVKYHGLSQRINGY 217 N +A + NK N+R+ + + + F + + +P ++ PVKY +S + + Y Sbjct: 251 NTSARKRLNKGFKANWRNFLGLRRNRTFFKCVIMPTALPPVKYEDISPKSDAY 303 >Z68009-2|CAA92004.2| 891|Caenorhabditis elegans Hypothetical protein R09A8.2 protein. Length = 891 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +1 Query: 46 NCEPEAVRDNFDYFNYGANDDVLKNLESQLSKDEVVLRPQEV 171 N + E + N +Y+ + + DD L +++ + + RP+EV Sbjct: 178 NNKTEKLETNAEYYGFKSYDDSLYDIQPNTKRPAPLYRPEEV 219 >U28943-10|AAA68362.1| 329|Caenorhabditis elegans Dehydrogenases, short chain protein7 protein. Length = 329 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/50 (20%), Positives = 24/50 (48%) Frame = +1 Query: 196 NVGQITAVSINSLGQPVIFHRADRVWDENTFNESNAYQNFDKGPIVEDTI 345 N+ Q + ++ G P + + + + WD N +E Y+ + ++D + Sbjct: 257 NISQGASTTVYCAGHPEVANVSGKYWDSNWDDEKGLYEEVARDEQLQDAL 306 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,753,707 Number of Sequences: 27780 Number of extensions: 229156 Number of successful extensions: 522 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -