BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0077 (519 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 46 2e-07 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 46 2e-07 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 42 4e-06 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 42 4e-06 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 40 2e-05 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 40 2e-05 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 31 0.005 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 27 0.12 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 1.4 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 23 1.9 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 1.9 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 1.9 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 23 1.9 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 23 1.9 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 23 1.9 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 23 1.9 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 23 1.9 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 23 1.9 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 1.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 1.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 1.9 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 1.9 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 1.9 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 1.9 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 3.3 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 3.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 3.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 4.3 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 5.7 AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. 21 7.6 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 46.0 bits (104), Expect = 2e-07 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 1/88 (1%) Frame = +2 Query: 41 GFPQRLMLPLGTIGGLEMQMYVIVSPVRTGMLLPTLDMTMMKDRCACRWSSC-ISTMPLG 217 GFP RL+LP G G+ Q+++ VSPV + + R W G Sbjct: 599 GFPGRLLLPRGKKEGMPFQLFLYVSPVSS-------EYNQYNSRI---WGGYKFDKRSFG 648 Query: 218 YPFDRPIDMASFFTSNMKFADVMIYRKD 301 +P D+P+ ++ NM F D++IY KD Sbjct: 649 FPLDKPLYDFNYEGPNMLFKDILIYHKD 676 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 46.0 bits (104), Expect = 2e-07 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 1/88 (1%) Frame = +2 Query: 41 GFPQRLMLPLGTIGGLEMQMYVIVSPVRTGMLLPTLDMTMMKDRCACRWSSC-ISTMPLG 217 GFP RL+LP G G+ Q+++ VSPV + + R W G Sbjct: 599 GFPGRLLLPRGKKEGMPFQLFLYVSPVSS-------EYNQYNSRI---WGGYKFDKRSFG 648 Query: 218 YPFDRPIDMASFFTSNMKFADVMIYRKD 301 +P D+P+ ++ NM F D++IY KD Sbjct: 649 FPLDKPLYDFNYEGPNMLFKDILIYHKD 676 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 41.9 bits (94), Expect = 4e-06 Identities = 25/95 (26%), Positives = 47/95 (49%), Gaps = 1/95 (1%) Frame = +2 Query: 41 GFPQRLMLPLGTIGGLEMQMYVIVSPVRTGMLLPTLDMTMMKDRCACRWSSCI-STMPLG 217 GFP+RL+LP G G+ + V+VSP ++ +D + W I +G Sbjct: 597 GFPERLLLPKGKKEGMPYNVLVVVSPFDDSNVVQ-IDSPV--------WGRHIYDGRAMG 647 Query: 218 YPFDRPIDMASFFTSNMKFADVMIYRKDLGMSNTS 322 +P D+P+D SN+ +V+++ +++ N + Sbjct: 648 FPLDKPVDPLLLVLSNIHVKEVLVHHREMEELNVA 682 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 41.9 bits (94), Expect = 4e-06 Identities = 25/95 (26%), Positives = 47/95 (49%), Gaps = 1/95 (1%) Frame = +2 Query: 41 GFPQRLMLPLGTIGGLEMQMYVIVSPVRTGMLLPTLDMTMMKDRCACRWSSCI-STMPLG 217 GFP+RL+LP G G+ + V+VSP ++ +D + W I +G Sbjct: 597 GFPERLLLPKGKKEGMPYNVLVVVSPFDDSNVVQ-IDSPV--------WGRHIYDGRAMG 647 Query: 218 YPFDRPIDMASFFTSNMKFADVMIYRKDLGMSNTS 322 +P D+P+D SN+ +V+++ +++ N + Sbjct: 648 FPLDKPVDPLLLVLSNIHVKEVLVHHREMEELNVA 682 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 39.5 bits (88), Expect = 2e-05 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 1/87 (1%) Frame = +2 Query: 41 GFPQRLMLPLGTIGGLEMQMYVIVSPVRTGMLLPTLDMTMMKD-RCACRWSSCISTMPLG 217 GFP+RL+LP G G+ +M+ +S ++D + K + G Sbjct: 601 GFPERLILPRGKPEGMRYKMFFFLS---------SMDESNTKSYEIPLYGKMTLDDKVFG 651 Query: 218 YPFDRPIDMASFFTSNMKFADVMIYRK 298 +P DRP+ +F NM F DV IY + Sbjct: 652 FPLDRPMWAWNFTIPNMYFKDVFIYNR 678 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 39.5 bits (88), Expect = 2e-05 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 1/87 (1%) Frame = +2 Query: 41 GFPQRLMLPLGTIGGLEMQMYVIVSPVRTGMLLPTLDMTMMKD-RCACRWSSCISTMPLG 217 GFP+RL+LP G G+ +M+ +S ++D + K + G Sbjct: 601 GFPERLILPRGKPEGMRYKMFFFLS---------SMDESNTKSYEIPLYGKMTLDDKVFG 651 Query: 218 YPFDRPIDMASFFTSNMKFADVMIYRK 298 +P DRP+ +F NM F DV IY + Sbjct: 652 FPLDRPMWAWNFTIPNMYFKDVFIYNR 678 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 31.5 bits (68), Expect = 0.005 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +2 Query: 209 PLGYPFDRPIDMASFFTSNMKFADVMIYRK 298 PLG+P DRP+ + + N+ DV+++ + Sbjct: 972 PLGFPLDRPLSLGALSVPNIFVKDVLVFHQ 1001 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 27.1 bits (57), Expect = 0.12 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 307 HVEHQQDRGHLGDGHDEGR--SHLPGLGHAGQEDLQRRH 417 + +HQQD G DG R S PG+GH G H Sbjct: 93 YYQHQQDHGSGMDGMGGYRSASPSPGMGHMGHTPTPNGH 131 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.4 bits (48), Expect = 1.4 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +1 Query: 22 VVQVSQRIPSETYAAPRYDWRFGDADVRHRVA 117 VV R+P E PR D+ D DV HRVA Sbjct: 170 VVPEGARVPIEI---PR-DYTASDLDVEHRVA 197 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S+ + DD++ Sbjct: 94 SNTSKTVILSDKLESSDDIS 113 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S + DD++ Sbjct: 94 SNTSKTVILSNKLESSDDIS 113 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKTV S + DD++ Sbjct: 94 SNTSKTVILSNKLESSDDIS 113 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 397 LDQHVRVQVGEIVLHHDH 344 L +H V +GEI HH++ Sbjct: 512 LQEHDSVMLGEISPHHEY 529 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 4.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 311 SNTSKTVDTSEMVMMKDDLT 370 SNTSKT+ S + DD++ Sbjct: 94 SNTSKTIILSNKLESSDDIS 113 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = -2 Query: 203 WRYMSSSDKHNGPSSWSCPMWARAYRCGPAT 111 W+Y ++++ H S+ W R G T Sbjct: 124 WKYYTTNESHACLSTGGSCYWPRGKNLGGTT 154 >AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. Length = 223 Score = 21.0 bits (42), Expect = 7.6 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 Query: 190 APATSTTVLHHGHVQCGQEHTGADRRHD 107 A TSTT + GHV E T D D Sbjct: 125 ANTTSTTKIIDGHVVAINETTYTDGSDD 152 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,243 Number of Sequences: 438 Number of extensions: 2460 Number of successful extensions: 41 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14477538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -