BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0076 (585 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase ki... 27 2.7 SPBC19F8.05 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 3.5 SPBC1105.15c |htd2||3-hydroxyacyl-ACP dehydratase Htd2 |Schizosa... 25 6.2 >SPAC1006.09 |win1|SPAC1250.06c, SPAPJ730.01|MAP kinase kinase kinase Win1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1436 Score = 26.6 bits (56), Expect = 2.7 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 484 ENVSLNILIPNSMKYYFNTKIKYVR 410 EN SLN ++ S+K+YFN + VR Sbjct: 619 ENQSLNNILVASLKFYFNLLHRKVR 643 >SPBC19F8.05 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 218 Score = 26.2 bits (55), Expect = 3.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 514 SNSKDNLNRFENVSLNILIPNSMKYYFNTKIKYV 413 + K+N+ + EN+S +L+ + YF KYV Sbjct: 111 AKKKENICKKENLSKTVLVRQLAEIYFANSNKYV 144 >SPBC1105.15c |htd2||3-hydroxyacyl-ACP dehydratase Htd2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 300 Score = 25.4 bits (53), Expect = 6.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 129 KPTRLCSSNIGNIWI 173 +P R+C S GN+WI Sbjct: 266 QPLRICISETGNLWI 280 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,130,184 Number of Sequences: 5004 Number of extensions: 42379 Number of successful extensions: 104 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -