BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0068 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0164 - 1326002-1326409,1326410-1326428,1326523-1326647,132... 37 0.015 01_06_1682 - 39130696-39131705,39132355-39132583 37 0.015 07_03_0600 + 19866757-19867218,19867920-19868429 32 0.42 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 31 0.98 03_03_0008 - 13674602-13674708,13675272-13675439,13676169-136767... 31 1.3 05_01_0142 - 940421-940701,941262-941574 30 1.7 03_05_0388 + 23726957-23727418,23730016-23730262,23731072-237312... 30 1.7 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 30 2.3 07_03_1067 + 23728642-23728690,23728832-23729010 30 2.3 02_01_0302 - 2021221-2023305 30 2.3 01_06_0747 - 31645136-31646521,31647870-31648142,31649080-316491... 30 2.3 11_01_0648 + 5254272-5254468,5254491-5254845,5254945-5255292 29 3.0 01_06_0046 + 25943183-25943590 29 3.0 08_01_0080 + 566509-566746,566904-567151,567347-567532,567639-56... 29 3.9 07_03_1160 - 24430240-24431268 29 3.9 11_01_0385 + 2915532-2916482 29 5.2 09_04_0430 + 17502387-17503505 29 5.2 05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 29 5.2 02_01_0077 - 546033-546223,546314-546566,546635-546865,547165-54... 29 5.2 01_07_0046 - 40714701-40714763,40715266-40715343,40716398-407164... 29 5.2 04_03_0904 + 20717005-20718087 28 6.9 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 28 9.1 >03_01_0164 - 1326002-1326409,1326410-1326428,1326523-1326647, 1327482-1327530,1328834-1328855,1328969-1329071 Length = 241 Score = 37.1 bits (82), Expect = 0.015 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = +3 Query: 195 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 341 PP Q P + PP YP PP SY PQ +Y PPQ Y Sbjct: 193 PPAQGYPPAAY--PPAGYPQGGAYPPPGSYPPPGSYPPQGSYPPPQGYY 239 >01_06_1682 - 39130696-39131705,39132355-39132583 Length = 412 Score = 37.1 bits (82), Expect = 0.015 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 11/60 (18%) Frame = +3 Query: 195 PPIQWKPQNTWNAPPKPIQ-PINTY-------PQNNYAPPQ---NSYYPQNTYAPPQNTY 341 PP Q+ P N++ APP P Y P N Y PP NS PQ ++PP N+Y Sbjct: 239 PPYQYTPPNSYQAPPTSYNHPPPPYGYNSPIPPTNKYLPPPYYFNSPPPQYQHSPPANSY 298 Score = 32.3 bits (70), Expect = 0.42 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 198 PIQWKPQNTWNAPPKPIQPINTYPQNNY-APPQNSYYPQNTYAPPQNTY 341 P Q+ P +N P P + PQ++Y +PP Y P N+Y P +Y Sbjct: 209 PNQFSPP-PFNKFPPPSHQYPSPPQSSYHSPPPYQYTPPNSYQAPPTSY 256 Score = 31.1 bits (67), Expect = 0.98 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = +3 Query: 195 PPIQWK-PQNTWNAPPKPIQPINTYPQNNYAPPQ---NSYYPQNTYAPP 329 PP+ + P + +PP P N+ P N+Y+PP S P Y+PP Sbjct: 301 PPLAHQYPPPPYKSPPIPPYYFNSPPANHYSPPPYNFGSSPPTYQYSPP 349 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 32.3 bits (70), Expect = 0.42 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +3 Query: 195 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 341 PP Q +P W PP P P PQ PPQ P YAPP Y Sbjct: 62 PPPQ-QPPAMWGQPPPP--P----PQYAPPPPQQFQLPHQQYAPPPQHY 103 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 31.1 bits (67), Expect = 0.98 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 6/53 (11%) Frame = +3 Query: 195 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSY------YPQNTYAPPQN 335 PP P + APP N Y ++ PP +SY YP + APP N Sbjct: 308 PPSYGGPGGDYAAPPSSYGGNNAYNSDSAVPPPSSYGGGPGSYPPSYGAPPPN 360 >03_03_0008 - 13674602-13674708,13675272-13675439,13676169-13676787, 13676868-13677330,13677855-13678036,13678093-13678235, 13678315-13678423,13679000-13679456,13680490-13682473, 13682507-13682626,13682920-13682971 Length = 1467 Score = 30.7 bits (66), Expect = 1.3 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 234 PPKPIQPIN-TYPQNNYAPPQNSYYPQNTYAPP 329 PP PI P+N P N+ P Y+ N + PP Sbjct: 1213 PPPPIAPLNPPGPHGNFPAPPAPYHGNNYHQPP 1245 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = +3 Query: 195 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 341 PP Q P + PP P P Y PP +Y P PPQ+ Y Sbjct: 30 PPHQGYPPQGYPPPPGAYPP----PPGAYPPPPGAYPPPPGAYPPQHGY 74 >03_05_0388 + 23726957-23727418,23730016-23730262,23731072-23731220, 23731313-23731597,23731665-23731889,23734251-23734445 Length = 520 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 198 PIQWKPQNTWNAPPKPIQP----INTYPQNNYAPPQNSYYP 308 P W P W PP + P +PQ PQ++YYP Sbjct: 301 PQPWGPPQPWGPPPSHLPPGGPGYGGHPQFMPPRPQDNYYP 341 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 29.9 bits (64), Expect = 2.3 Identities = 21/50 (42%), Positives = 29/50 (58%) Frame = +2 Query: 185 EPEPAYPVETSKYVERSTQADPADKHLSPKQLRPPSKLILSSEYLCTSSK 334 EP PA +E + + ++D A LSP++ R PS L LSS YL S+K Sbjct: 1437 EPSPA--LEKKRIEKVKPKSDAA---LSPEESRKPSGLQLSSTYLQGSTK 1481 >07_03_1067 + 23728642-23728690,23728832-23729010 Length = 75 Score = 29.9 bits (64), Expect = 2.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 234 PPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQ 332 PP P YP Y PPQ Y P PPQ Sbjct: 30 PPAGYPPAQGYPPAGY-PPQQGYPPPYAQPPPQ 61 >02_01_0302 - 2021221-2023305 Length = 694 Score = 29.9 bits (64), Expect = 2.3 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = +3 Query: 195 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 341 PP PQ+T P P P+ P PP ++ P +APP +Y Sbjct: 528 PPSHSPPQSTPTHPSYPSPPVTYTP----PPPTSADRPDVRFAPPPGSY 572 >01_06_0747 - 31645136-31646521,31647870-31648142,31649080-31649148, 31649486-31649614 Length = 618 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 5/53 (9%) Frame = +3 Query: 195 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQN-----SYYPQNTYAPPQNT 338 PP+Q + NT PP+ +QP P N PQ Y P + PP T Sbjct: 397 PPVQPQQSNT-QLPPQAMQPQQHPPVQNQMRPQTPPNYPHYQPHQSLNPPPET 448 >11_01_0648 + 5254272-5254468,5254491-5254845,5254945-5255292 Length = 299 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 185 EPEPAYPVETSKYVERSTQADPADKHLSPKQLRP 286 +P P Y ET+ + + +D ADK + P+++ P Sbjct: 260 QPRPYYQGETNGVAKEAPSSDSADKEIQPEKVVP 293 >01_06_0046 + 25943183-25943590 Length = 135 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 231 APPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTY 341 +PP P P P Y+PP +YYP + PP Y Sbjct: 49 SPPPPALPPPP-PYYYYSPPPPAYYPGSYCPPPPAAY 84 >08_01_0080 + 566509-566746,566904-567151,567347-567532,567639-567734, 567836-567907,567990-568106,570531-571676 Length = 700 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 6/54 (11%) Frame = +3 Query: 198 PIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYY------PQNTYAPPQNTY 341 P +PQ +APP+ P P+ N P YY PQ Y P Q+ Y Sbjct: 440 PNYGQPQYPQSAPPQNYGPGYGDPRYNAPAPNQQYYGQPPAGPQQGYPPQQDPY 493 >07_03_1160 - 24430240-24431268 Length = 342 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +3 Query: 213 PQNTWNAPPKPIQPINTYPQNNYAPPQ----NSYYPQNTYAPPQNTY 341 PQ N PPKP QP P P Q N P PPQ Y Sbjct: 272 PQPNPNGPPKPDQPPQPNPNGPSKPDQPPRPNPDMPPKPDQPPQPEY 318 >11_01_0385 + 2915532-2916482 Length = 316 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 204 QWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPP 329 QW P +N PP P P +P N + PP ++P T A P Sbjct: 178 QWPPLPPFNQPPTPEWP---HPGNKW-PPLPPFHPPPTPAWP 215 >09_04_0430 + 17502387-17503505 Length = 372 Score = 28.7 bits (61), Expect = 5.2 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 234 PPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNT 338 PP P+Q P PP+ + P APPQ+T Sbjct: 159 PPAPMQQPQPQPPPQPTPPRAAPLPTPPRAPPQST 193 >05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 Length = 574 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +3 Query: 195 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAP--PQNSYYPQNTYAPPQNTYR 344 P Q Q + P +Q + P AP PQ SYYP + P T++ Sbjct: 283 PQSQPPSQFPGHLPHSQVQSVPPAPPTPLAPTIPQESYYPPSAVQPTDTTHQ 334 >02_01_0077 - 546033-546223,546314-546566,546635-546865,547165-547331, 547369-548008 Length = 493 Score = 28.7 bits (61), Expect = 5.2 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = +3 Query: 195 PPIQWKPQNTWNAPPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQ 332 PP Q +P APP P Q P + PP+ P T PPQ Sbjct: 67 PPSQ-EPDTPEPAPPTPPQQ-QQQPWQSPLPPRREPAPPRTVVPPQ 110 >01_07_0046 - 40714701-40714763,40715266-40715343,40716398-40716462, 40717075-40717201,40717279-40717319,40717621-40717690, 40718070-40718191,40719047-40719107,40719182-40719292, 40719387-40719461,40719815-40719842,40719929-40719978, 40720228-40720290,40720385-40720426,40720562-40720631, 40720663-40720713,40721857-40722041,40722374-40722775 Length = 567 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 274 TITPPLKTHTILRIPMHLLKTPIVPP 351 T+ PP+KT T LR P + + PP Sbjct: 163 TVVPPIKTSTTLRTPSPIPPVAVEPP 188 >04_03_0904 + 20717005-20718087 Length = 360 Score = 28.3 bits (60), Expect = 6.9 Identities = 21/51 (41%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +3 Query: 198 PIQWKPQNTWNAPP--KPIQPINTYPQNNYAPPQNSYYPQNTYAPPQNTYR 344 P +KPQ N PP KP QP P Y P +Y PQ PP TY+ Sbjct: 215 PPSYKPQPKPNPPPTYKP-QP-KPNPPPTYKPAPPTYKPQPKPNPPP-TYK 262 Score = 28.3 bits (60), Expect = 6.9 Identities = 22/51 (43%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 195 PPIQWKPQNTWNAPP--KPIQPINTY-PQNNYAPPQNSYYPQNTYAPPQNT 338 PP +KPQ N PP KP P TY PQ PP +Y PQ P T Sbjct: 226 PPPTYKPQPKPNPPPTYKPAPP--TYKPQPKPNPPP-TYKPQPKPTPTPYT 273 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 27.9 bits (59), Expect = 9.1 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +3 Query: 234 PPKPIQPINTYPQNNYAPPQNSYYPQNTYAPPQ 332 PP+ ++P+ +P APP YY P+ Sbjct: 193 PPEALRPLPPFPPTMLAPPAYPYYHPQPQPDPE 225 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,452,713 Number of Sequences: 37544 Number of extensions: 437255 Number of successful extensions: 1494 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1471 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -