BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0067 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 25 0.71 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 25 0.71 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 25 0.71 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 25 0.71 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 25 0.71 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 25 0.71 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 25 0.71 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 25 0.71 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 3.8 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 5.0 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 0.71 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 294 YNPEASSLRPPS-FSLHAVGPQATS--WIRPTPSIGNDRVLG 178 YNP A+S PP+ +S V PQ + P P G +G Sbjct: 30 YNPNANSTYPPACYSPPQVAPQYPQHPYAAPAPGHGLQPTMG 71 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 0.71 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 294 YNPEASSLRPPS-FSLHAVGPQATS--WIRPTPSIGNDRVLG 178 YNP A+S PP+ +S V PQ + P P G +G Sbjct: 30 YNPNANSTYPPACYSPPQVAPQYPQHPYAAPAPGHGLQPTMG 71 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 24.6 bits (51), Expect = 0.71 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 294 YNPEASSLRPPS-FSLHAVGPQATS--WIRPTPSIGNDRVLG 178 YNP A+S PP+ +S V PQ + P P G +G Sbjct: 30 YNPNANSTYPPACYSPPQVAPQYPQHPYAAPAPGHGLQPTMG 71 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.6 bits (51), Expect = 0.71 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 294 YNPEASSLRPPS-FSLHAVGPQATS--WIRPTPSIGNDRVLG 178 YNP A+S PP+ +S V PQ + P P G +G Sbjct: 30 YNPNANSTYPPACYSPPQVAPQYPQHPYAAPAPGHGLQPTMG 71 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 24.6 bits (51), Expect = 0.71 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 294 YNPEASSLRPPS-FSLHAVGPQATS--WIRPTPSIGNDRVLG 178 YNP A+S PP+ +S V PQ + P P G +G Sbjct: 30 YNPNANSTYPPACYSPPQVAPQYPQHPYAAPAPGHGLQPTMG 71 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 24.6 bits (51), Expect = 0.71 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 294 YNPEASSLRPPS-FSLHAVGPQATS--WIRPTPSIGNDRVLG 178 YNP A+S PP+ +S V PQ + P P G +G Sbjct: 30 YNPNANSTYPPACYSPPQVAPQYPQHPYAAPAPGHGLQPTMG 71 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 24.6 bits (51), Expect = 0.71 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 294 YNPEASSLRPPS-FSLHAVGPQATS--WIRPTPSIGNDRVLG 178 YNP A+S PP+ +S V PQ + P P G +G Sbjct: 30 YNPNANSTYPPACYSPPQVAPQYPQHPYAAPAPGHGLQPTMG 71 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 24.6 bits (51), Expect = 0.71 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 294 YNPEASSLRPPS-FSLHAVGPQATS--WIRPTPSIGNDRVLG 178 YNP A+S PP+ +S V PQ + P P G +G Sbjct: 30 YNPNANSTYPPACYSPPQVAPQYPQHPYAAPAPGHGLQPTMG 71 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 Query: 464 IRWYINGHEMEDTRG 508 I W +NGH ++ T G Sbjct: 636 ISWTLNGHFIDQTNG 650 Score = 21.0 bits (42), Expect = 8.8 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +1 Query: 166 TGRRAEYTIVSNTRSGTDPTGSLW 237 T RR + ++ G P G LW Sbjct: 807 TSRRGDPAVLQCEAKGEKPIGILW 830 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.8 bits (44), Expect = 5.0 Identities = 5/13 (38%), Positives = 10/13 (76%) Frame = -2 Query: 511 FAPCVFHFMSVYV 473 F PC+++F S ++ Sbjct: 208 FLPCIYYFYSAFI 220 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,710 Number of Sequences: 336 Number of extensions: 3316 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -