BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0061 (600 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 2.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 23 2.3 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.2 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = -3 Query: 418 FPKIASVFIAYV*MSAAREDYESREPNRPFDSTCGERIH*YYD 290 + KI S F+ Y + E + P F+S ++++ Y+D Sbjct: 424 YQKILSYFLRYKKLQPQYSQSELQMPGVKFESVNIDKLYTYFD 466 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 Query: 228 YRRAEPYPQLGHPSRGPRVN 287 YR A P P +GH P N Sbjct: 110 YRSASPSPGMGHMGHTPTPN 129 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/43 (23%), Positives = 20/43 (46%) Frame = -3 Query: 418 FPKIASVFIAYV*MSAAREDYESREPNRPFDSTCGERIH*YYD 290 + I S F+ Y + E + P F+S ++++ Y+D Sbjct: 424 YQNILSYFLRYKKLQPQYSQSELQMPGVKFESVNIDKLYTYFD 466 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,874 Number of Sequences: 438 Number of extensions: 3103 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -