BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0059 (613 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) 84 1e-16 SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) 31 0.97 SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) 30 1.3 SB_56325| Best HMM Match : Ribosomal_L14e (HMM E-Value=0.84) 29 3.0 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 29 3.0 SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_18926| Best HMM Match : Colipase_C (HMM E-Value=0.0043) 29 3.9 SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) 28 6.9 SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) 28 6.9 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 27 9.1 SB_4930| Best HMM Match : ANF_receptor (HMM E-Value=0) 27 9.1 >SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) Length = 50 Score = 83.8 bits (198), Expect = 1e-16 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +3 Query: 252 MRGAFGKPQGTVARVRIGQPIMSVRSSDRWKAQVIEALRRAKFKFPGRQK 401 MRGAFGKPQGTVARV IGQ I+S+R+ D KA IEALRRAKFKFPGRQK Sbjct: 1 MRGAFGKPQGTVARVNIGQTIISIRTKDGNKAAAIEALRRAKFKFPGRQK 50 >SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1278 Score = 30.7 bits (66), Expect = 0.97 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -3 Query: 410 YVDLLTSGELELGTAQSLDDLCLPPVTRAHGHDGLSNANT--CYSTLRLAKRTT 255 Y + ++G + T D+C+P + HGH +ANT CY + A +T Sbjct: 68 YAESCSAGHYVVRTGNPFTDICIP--CQCHGHSDQCDANTGICYVRIYTADLST 119 >SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) Length = 177 Score = 30.7 bits (66), Expect = 0.97 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 102 LEAGRICCNKYLVKNCGKDQFHIRMRLHPFHVIRINKMLS 221 L I C Y KN +D +RM +HP H IRIN ++S Sbjct: 115 LSYAHIFCGSYS-KNAAEDI--VRMSVHPLHPIRINGVVS 151 >SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) Length = 1023 Score = 30.3 bits (65), Expect = 1.3 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = -2 Query: 303 QCEHVLQYPEACQTHHASQSGAYQLQRMITFY*CG*RGKGEVSCGYGTDPFRSSLRGTYC 124 +C V Q P AC + S GA + Y C K V CG G T C Sbjct: 535 KCPDVTQAPVACTNGYYSGDGATECTLCPAGYSCADATKSPVPCGKGYYSTNGQTSCTEC 594 Query: 123 SRYVLPPKPLSSA 85 S P L ++ Sbjct: 595 SAGFYCPVELGTS 607 >SB_56325| Best HMM Match : Ribosomal_L14e (HMM E-Value=0.84) Length = 650 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 133 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 2 Y+++QI+ ASK L + T C + K S V F+ K K R Sbjct: 252 YIVKQIQVASKVKVLKAKLENQTLCQQT-KRSKVTDFISKQKSR 294 >SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 1273 Score = 29.1 bits (62), Expect = 3.0 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -1 Query: 133 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 2 Y+++QI+ ASK L + T C + K S V F+ K K R Sbjct: 1020 YIVKQIQVASKVKVLKAKLENQTLCQQT-KRSKVTDFISKQKSR 1062 >SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2077 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/55 (21%), Positives = 26/55 (47%) Frame = +3 Query: 258 GAFGKPQGTVARVRIGQPIMSVRSSDRWKAQVIEALRRAKFKFPGRQKIYVSKKW 422 G G+P G+V + +++++ +W + E++ A + FP S+ W Sbjct: 1109 GVDGRPSGSVEILGSRDSFVAIQNGRQWMLDIEESISIAFYVFPNNSLGNTSRNW 1163 >SB_18926| Best HMM Match : Colipase_C (HMM E-Value=0.0043) Length = 811 Score = 28.7 bits (61), Expect = 3.9 Identities = 25/86 (29%), Positives = 35/86 (40%), Gaps = 1/86 (1%) Frame = +1 Query: 313 SCPCALVTGGRHRSSRLCAVPSSSSPDVKRSTYQRSGVSQSMNVMSLRSCVKXAASLMTA 492 +CPCA R S C SSSPD + Y+ S + +V+ + L Sbjct: 432 NCPCA-----RAMDSATCEHDKSSSPDFTAAKYKYSSATDMDSVICEQEECSCLDHLSAN 486 Query: 493 ALCSTARNMDLSTLGGRFRLR-SSCI 567 A S R M+ T RL +SC+ Sbjct: 487 AEYSNKREMEGVTCVESTRLELTSCV 512 >SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) Length = 726 Score = 27.9 bits (59), Expect = 6.9 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 260 CVWQASGYCSTCSHWTAHHV 319 C W +G C C HW HV Sbjct: 79 CYWIRTGCCHLCWHWRPLHV 98 >SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) Length = 883 Score = 27.9 bits (59), Expect = 6.9 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +1 Query: 289 HVFALDSPSCPCALVTGGRHRSSRLCAVPSSSSPDVKRSTYQRSGVSQSMNVMS 450 HV A P P + + + +S A+ +SS+P + S Q + + + N S Sbjct: 261 HVIANQHPPAPVSQLQSNSNNASAARAITTSSNPSISTSVLQGNLSTNARNTAS 314 >SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) Length = 434 Score = 27.5 bits (58), Expect = 9.1 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = +3 Query: 408 VSKKWGFTKYE---RDEFEKLREXGRLANDGCIVQYRPEHGPLDAW 536 V K W T +E + LR R D CI+ Y+ ++GPL W Sbjct: 390 VFKDWNCTYHELLIKANLSTLRN--RRLQDICILMYKVKNGPLPIW 433 >SB_4930| Best HMM Match : ANF_receptor (HMM E-Value=0) Length = 1127 Score = 27.5 bits (58), Expect = 9.1 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 115 RPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 2 R +S+ S+ SC+ S + SGK + LF KS+ R Sbjct: 983 RKSSRTSQRSCASSMSSSSAESGKLEQLNLFDGKSRKR 1020 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,255,394 Number of Sequences: 59808 Number of extensions: 444350 Number of successful extensions: 1360 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1360 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -