BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0051 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 22 4.5 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 22 4.5 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 22 4.5 DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. 22 5.9 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 22.2 bits (45), Expect = 4.5 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -2 Query: 133 DDR*VVASRDASLLTSPECYCCETMFIHVAKLIRT*RPSIR 11 DD+ V++S+ S SP E I + L + PSIR Sbjct: 344 DDKKVISSKSGSKANSPFPGSTEADIIELQDLRMSPLPSIR 384 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -2 Query: 88 SPECYCCETMFI 53 S ECYCC ++ Sbjct: 88 SKECYCCRESYL 99 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 22.2 bits (45), Expect = 4.5 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -2 Query: 88 SPECYCCETMFI 53 S ECYCC ++ Sbjct: 88 SKECYCCRESYL 99 >DQ435324-1|ABD92639.1| 152|Apis mellifera OBP3 protein. Length = 152 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 83 RMLLL*NNVYTRGEVDTYLASVDKD 9 R+ L+ +NV+ + D YL D D Sbjct: 63 RLALMNDNVFDVSKFDVYLNDTDMD 87 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,128 Number of Sequences: 438 Number of extensions: 2450 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -