BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0050 (600 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 3.3 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 5.7 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.2 bits (50), Expect = 3.3 Identities = 15/69 (21%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +2 Query: 239 VGASEATLLNMLNISPFS-YGLVVKQVYDSGT--IFAPEILDIKPEDLRAKFQAGVANVA 409 VG +E+ +++N+ F+ Y + + +Y +G + + +KPED+ +A + Sbjct: 261 VGVTESA--DLINLEKFAQYAVAIAAMYKTGLGKLSEKATVKVKPEDVPLNLRAHDVSTH 318 Query: 410 ALSLAIGYP 436 +++L+ P Sbjct: 319 SMTLSWAPP 327 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.4 bits (48), Expect = 5.7 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -3 Query: 115 GGNDD*QWGNGTGTSWSLDFVLQQFV-TDLNEVXRG 11 GGND +W + G +W L + FV D ++ RG Sbjct: 287 GGNDALRWLSNFGEAWRLLASREAFVFVDNHDNQRG 322 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 641,602 Number of Sequences: 2352 Number of extensions: 13323 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -