BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0047 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 33 0.006 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 3.6 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 33.5 bits (73), Expect = 0.006 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +2 Query: 332 TYAYLIRXAIIESADKQVTLNEIYNWXQSTFCYFR 436 +YA LI AI ++D ++TL++IY W YF+ Sbjct: 120 SYADLITQAISSASDSRLTLSQIYEWMVQNVPYFK 154 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 3.6 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 151 HHGGQAVPLAP 119 HHGG+ VP+ P Sbjct: 1325 HHGGEGVPMGP 1335 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 451,775 Number of Sequences: 2352 Number of extensions: 7050 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -