BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brP-0047
(650 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 33 0.006
CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 3.6
>AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative
transcription factor protein.
Length = 593
Score = 33.5 bits (73), Expect = 0.006
Identities = 14/35 (40%), Positives = 22/35 (62%)
Frame = +2
Query: 332 TYAYLIRXAIIESADKQVTLNEIYNWXQSTFCYFR 436
+YA LI AI ++D ++TL++IY W YF+
Sbjct: 120 SYADLITQAISSASDSRLTLSQIYEWMVQNVPYFK 154
>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal
structural protein protein.
Length = 1645
Score = 24.2 bits (50), Expect = 3.6
Identities = 7/11 (63%), Positives = 9/11 (81%)
Frame = -2
Query: 151 HHGGQAVPLAP 119
HHGG+ VP+ P
Sbjct: 1325 HHGGEGVPMGP 1335
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 451,775
Number of Sequences: 2352
Number of extensions: 7050
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 64395870
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -