BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0039 (751 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 24 1.3 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 23 4.0 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 24.2 bits (50), Expect = 1.3 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 171 N*LLNTSKSI-EDNSSVTTVDIIQCRIDN 88 N L+N K I E NS + ++QC IDN Sbjct: 97 NRLVNNCKDITESNSCKKSSKLLQCFIDN 125 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 22.6 bits (46), Expect = 4.0 Identities = 13/53 (24%), Positives = 24/53 (45%) Frame = +1 Query: 472 VNDSLTERAAQFGLILDDISITHLTFGKEFTQAVELKQVAQQEAEKARFLXEK 630 ++DSL FG + + + L E + +EL + ++ E FL E+ Sbjct: 23 ISDSLVNAKLAFGFLDNSVWADGLLVFYEVFRYLELAMIRWKDTEIGLFLHEE 75 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,793 Number of Sequences: 438 Number of extensions: 3326 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -