BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0036 (627 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 275 8e-76 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 25 2.6 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 25 2.6 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 3.4 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 23 7.9 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 275 bits (674), Expect = 8e-76 Identities = 131/174 (75%), Positives = 149/174 (85%) Frame = +2 Query: 5 IIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPK 184 +IKA E D+FET I QA++ELE NSDLK QLR+LYIT+A+E+E +NKK+IIIYVP+PK Sbjct: 7 VIKAGNGEPDAFETQIGQAILELEMNSDLKPQLRDLYITRAREVEFNNKKAIIIYVPVPK 66 Query: 185 LKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDA 364 KAFQK+Q RLVRELEKKFSGKHVVF+ +R+ILPKP R NKQKRPRS +T+VYDA Sbjct: 67 QKAFQKVQTRLVRELEKKFSGKHVVFIAERRILPKPMRGRRDPNKQKRPRSPNVTAVYDA 126 Query: 365 ILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKXDTXQXXYKKLTG 526 ILEDLVFPAE+VGKRIRVKLDGSQLIKVHLDKNQQTTIEHK DT YKKLTG Sbjct: 127 ILEDLVFPAEVVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFASVYKKLTG 180 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.6 bits (51), Expect = 2.6 Identities = 17/44 (38%), Positives = 28/44 (63%) Frame = +2 Query: 344 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTT 475 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T Sbjct: 35 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMT 75 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.6 bits (51), Expect = 2.6 Identities = 17/44 (38%), Positives = 28/44 (63%) Frame = +2 Query: 344 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTT 475 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T Sbjct: 35 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMT 75 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 24.2 bits (50), Expect = 3.4 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -1 Query: 426 SNLTLMRLPTISAGKTKSSRIASYTEVNVLERGLFCLLATRVLWLGLGRIL 274 +N L+ +P + T SSR + L CLLAT V+W G++L Sbjct: 54 ANSRLVTVPAPAKELTDSSRSGGLPSSSS-SSSLSCLLATIVMWC-TGQVL 102 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 23.0 bits (47), Expect = 7.9 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 241 ELLFELTDKPDLDLLKGLQFRHRHIDDDR 155 ELLFE P LDLLK + +I D+ Sbjct: 96 ELLFEGVKDPLLDLLKTINSTSLNIPFDK 124 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 529,836 Number of Sequences: 2352 Number of extensions: 10524 Number of successful extensions: 35 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -