BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0032 (550 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68270-5|CAA92570.1| 174|Caenorhabditis elegans Hypothetical pr... 32 0.31 AF148954-1|AAD37411.1| 4280|Caenorhabditis elegans myotactin for... 29 2.2 AF148953-1|AAD37410.1| 4450|Caenorhabditis elegans myotactin for... 29 2.2 AF040648-5|AAK21413.1| 4450|Caenorhabditis elegans Lethal protei... 29 2.2 AF040648-4|AAK21414.2| 4280|Caenorhabditis elegans Lethal protei... 29 2.2 >Z68270-5|CAA92570.1| 174|Caenorhabditis elegans Hypothetical protein ZC410.5a protein. Length = 174 Score = 31.9 bits (69), Expect = 0.31 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 2/75 (2%) Frame = +2 Query: 95 QGIWYEISKFPNESEKNGK--CSSAEYKLEGDVVKVKNVHIIDGVKKYIEGTAKLTDDAN 268 QG+ ++ F + +N K S+ + +LE +V +VK+ ++ G+K+ ++G L +DA Sbjct: 36 QGVTSDVGNFFSNQFQNAKDLFSNDQNELEKNVQRVKD--LLTGLKEKVKGLEPLANDAQ 93 Query: 269 KAAKLTVTFKFGEIS 313 K V E+S Sbjct: 94 KETLKKVDGFLAEVS 108 >AF148954-1|AAD37411.1| 4280|Caenorhabditis elegans myotactin form A protein. Length = 4280 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 44 GTCPELKPVNNFNLTAYQGIWYEIS-KFPNESEKNGKCSSAEYKLE 178 G L P N NL + + +S + PN++ + KCS+ YKLE Sbjct: 2421 GCAAPLSPPTNLNLASPSNVQVRVSWQAPNQN--SWKCSAIRYKLE 2464 >AF148953-1|AAD37410.1| 4450|Caenorhabditis elegans myotactin form B protein. Length = 4450 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 44 GTCPELKPVNNFNLTAYQGIWYEIS-KFPNESEKNGKCSSAEYKLE 178 G L P N NL + + +S + PN++ + KCS+ YKLE Sbjct: 2421 GCAAPLSPPTNLNLASPSNVQVRVSWQAPNQN--SWKCSAIRYKLE 2464 >AF040648-5|AAK21413.1| 4450|Caenorhabditis elegans Lethal protein 805, isoform b protein. Length = 4450 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 44 GTCPELKPVNNFNLTAYQGIWYEIS-KFPNESEKNGKCSSAEYKLE 178 G L P N NL + + +S + PN++ + KCS+ YKLE Sbjct: 2421 GCAAPLSPPTNLNLASPSNVQVRVSWQAPNQN--SWKCSAIRYKLE 2464 >AF040648-4|AAK21414.2| 4280|Caenorhabditis elegans Lethal protein 805, isoform a protein. Length = 4280 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 44 GTCPELKPVNNFNLTAYQGIWYEIS-KFPNESEKNGKCSSAEYKLE 178 G L P N NL + + +S + PN++ + KCS+ YKLE Sbjct: 2421 GCAAPLSPPTNLNLASPSNVQVRVSWQAPNQN--SWKCSAIRYKLE 2464 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,455,911 Number of Sequences: 27780 Number of extensions: 161325 Number of successful extensions: 463 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1113119490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -