BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0031 (800 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0199 - 23165776-23166259,23166356-23167128,23167633-231678... 29 4.3 04_04_1547 - 34306836-34308713,34308938-34309048,34310056-34310202 29 4.3 12_02_0592 + 20868884-20868954,20869091-20869216,20869554-208698... 28 7.5 10_08_0914 + 21535519-21535797,21535961-21536339,21536425-215365... 28 7.5 12_01_0673 - 5745956-5750346,5750788-5750872,5751018-5751082,575... 28 9.9 04_04_0991 - 29969162-29969912,29970097-29970368 28 9.9 03_06_0501 - 34380155-34380637,34380961-34381029,34382206-343822... 28 9.9 >05_05_0199 - 23165776-23166259,23166356-23167128,23167633-23167869, 23167973-23168197 Length = 572 Score = 29.1 bits (62), Expect = 4.3 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Frame = +3 Query: 33 ASGELSILHS-PESLSFSGSSKTFESLLKEIFSASLGLSVEENSEWNGLLITDPFNTPEA 209 A G L +++S P SLS + S +F SLL S G S+ L+T P + P + Sbjct: 4 APGSLPLVNSRPVSLSLAASRSSFSSLL----SGGAGSSLN--------LMTPPSSLPPS 51 Query: 210 VVEVYISGISSLG 248 Y G+SS G Sbjct: 52 SPSSYFGGVSSSG 64 >04_04_1547 - 34306836-34308713,34308938-34309048,34310056-34310202 Length = 711 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 258 DFKSKKYPLVVDEYEPDTFDVLKHRINQRFTNG 356 DF YP+ EY P FDV H +RF NG Sbjct: 311 DFGGDMYPVEDYEYAPADFDVRAHHERERF-NG 342 >12_02_0592 + 20868884-20868954,20869091-20869216,20869554-20869862, 20870017-20870300,20870410-20871305,20871586-20871642, 20872293-20872340,20873046-20873114 Length = 619 Score = 28.3 bits (60), Expect = 7.5 Identities = 22/88 (25%), Positives = 40/88 (45%) Frame = +3 Query: 168 NGLLITDPFNTPEAVVEVYISGISSLGSSADFKSKKYPLVVDEYEPDTFDVLKHRINQRF 347 N +L PF TP+ + ++ + + G SAD PL D+ +P + ++ QR Sbjct: 255 NFILGAMPFGTPQDLNYANVTSVRTTGFSAD------PLPTDQKQP-AWKPYLYKGRQRT 307 Query: 348 TNGGNKLVNINLSDSDQLLSYSNVLGDL 431 + +N L D D + + +V G + Sbjct: 308 LFSSLETLNAALYDRDDVQDFLSVSGQV 335 >10_08_0914 + 21535519-21535797,21535961-21536339,21536425-21536568, 21536681-21536730,21536820-21536877,21536979-21537208 Length = 379 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/54 (24%), Positives = 29/54 (53%) Frame = +3 Query: 9 ISSIIGINASGELSILHSPESLSFSGSSKTFESLLKEIFSASLGLSVEENSEWN 170 I S +G+ +SG+L L + + + G++ + + +E+ S + L E+ W+ Sbjct: 198 IQSAVGVRSSGDLMTLTAAAATALRGAATMKQRVQREMRSNASVLPYEKGHSWS 251 >12_01_0673 - 5745956-5750346,5750788-5750872,5751018-5751082, 5751816-5751993 Length = 1572 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 426 DLDIPKVKKQSLQHLKSSVEEDFQFLS 506 D+DI KV K S QHL + ++ F+F S Sbjct: 551 DIDIMKVLKLSYQHLPTELQICFRFCS 577 >04_04_0991 - 29969162-29969912,29970097-29970368 Length = 340 Score = 27.9 bits (59), Expect = 9.9 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +3 Query: 399 LLSYSNVLGDLDIPKVKKQSLQHLKSSVEEDFQFLSELAALKAVTEKVESGAISADNIID 578 LLS LG LD + Q LQHL +S+ ++ A L A + +++ + + Sbjct: 164 LLSAVASLGSLDTALRQFQLLQHLLNSITSSSSDVAATAGLMATNLAATNTMVNSSSNVA 223 Query: 579 FYNLRINSL-HA 611 + ++N+L HA Sbjct: 224 SFQEQMNALAHA 235 >03_06_0501 - 34380155-34380637,34380961-34381029,34382206-34382229, 34382622-34382786 Length = 246 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +3 Query: 450 KQSLQHLKSSVEEDFQFLSELAALKAVTEKVESGAISADNIIDFYNLRINSLHAL 614 K L HL+S EED Q L+E L +E+ A+ A N+ + + +H + Sbjct: 157 KSDLNHLRSVPEEDGQALAEKEGLSF----LETSALEALNVEKAFQTILKDIHQI 207 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,849,965 Number of Sequences: 37544 Number of extensions: 326778 Number of successful extensions: 874 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 874 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -