BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0031 (800 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_3273| Best HMM Match : Neuromodulin (HMM E-Value=1.9) 31 1.1 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_31142| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_13793| Best HMM Match : Helicase_C (HMM E-Value=5.6) 30 1.9 SB_48172| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 29 5.8 SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) 29 5.8 SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) 28 7.7 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Frame = +3 Query: 339 QRFTNGGNKLVNINLSDSDQLLSYSNVLGDLDI-PKVKKQSLQHLKSSVEEDFQFLSELA 515 QRFT NK+V + LS + ++ Y L +LD+ + +Q L+ +E E Sbjct: 2053 QRFTGELNKIVLLLLSLTQRMHRYEKTLSELDMSEEADRQQRDILQEKIEYVKNQYEEAC 2112 Query: 516 ALKAVTEK 539 +K V +K Sbjct: 2113 KIKEVNDK 2120 >SB_3273| Best HMM Match : Neuromodulin (HMM E-Value=1.9) Length = 457 Score = 31.1 bits (67), Expect = 1.1 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 1/95 (1%) Frame = +3 Query: 306 DTFDVLKHRINQRFTNGGNKLVNINLSDSDQLLSYSNVLGDL-DIPKVKKQSLQHLKSSV 482 DT D + HR +G + + +L D++L + VL + +I + SL ++ V Sbjct: 32 DTIDPVVHRYEHAVHSGSHSSGSQSLP-GDEVLDWDQVLKRVREIEEAGTCSLGG-ETDV 89 Query: 483 EEDFQFLSELAALKAVTEKVESGAISADNIIDFYN 587 E+ + E ALK V E VESG S + D N Sbjct: 90 SEESRVTVEEPALKRVKEAVESGDESIFEVDDDTN 124 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 7/99 (7%) Frame = +3 Query: 186 DPFNTPEAVVEVYISGISSLGSSADFKSKKYPLVVDEYEPDTFDVLKHRINQR--FTNG- 356 DP + + VY+ + S ++ FK + Y + + E+ P TF V+K R +NG Sbjct: 1251 DPVDPRWSAAVVYVEVLDSNDNAPVFKKQSYVVEMVEHSPTTFTVVKVEATDRDVGSNGR 1310 Query: 357 -GNKLVNINLSDSDQLLSYSNVL---GDLDIPKVKKQSL 461 +V+ N+ + + S S V+ D+D K+++ L Sbjct: 1311 ISYSIVSGNVDGAFVIDSSSGVIKPAQDIDREKIQRYLL 1349 >SB_31142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 31.1 bits (67), Expect = 1.1 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 1/95 (1%) Frame = +3 Query: 306 DTFDVLKHRINQRFTNGGNKLVNINLSDSDQLLSYSNVLGDL-DIPKVKKQSLQHLKSSV 482 DT D + HR +G + + +L D++L + VL + +I + SL ++ V Sbjct: 364 DTIDPVVHRYEHAVHSGSHSSGSQSLP-GDEVLDWDQVLKRVREIEEAGTCSLGG-ETDV 421 Query: 483 EEDFQFLSELAALKAVTEKVESGAISADNIIDFYN 587 E+ + E ALK V E VESG S + D N Sbjct: 422 SEESRVTVEEPALKRVKEAVESGDESIFEVDDDTN 456 >SB_13793| Best HMM Match : Helicase_C (HMM E-Value=5.6) Length = 146 Score = 30.3 bits (65), Expect = 1.9 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 3/80 (3%) Frame = +3 Query: 321 LKHRINQRFTNGGNKLVNINLSDSDQLLSYSNVLGDLDIPKVKKQSLQHLKSSVEEDF-- 494 L+HR+ FT G+ VNIN+SD + + +VLG+ I + + L L+ + Sbjct: 53 LRHRMGF-FTKSGD--VNINVSDVNNIAFSRSVLGNPTISRARGYQLHQLEDRAIHELLE 109 Query: 495 QFLSELAALKAVT-EKVESG 551 + A + VT E+V SG Sbjct: 110 HYGGRFNACELVTVERVPSG 129 >SB_48172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 29.9 bits (64), Expect = 2.5 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +3 Query: 63 PESLSFSGSSKTFESLLKEIFSASLGLSVEENSEWNGLLITDPFNTPE 206 PE S SGS + L FS ++ S +E+ W LL+TD +N P+ Sbjct: 405 PEMNSSSGSPSCLDVL--SCFSVNVASS-KESKFWCELLVTDKYNAPD 449 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = -2 Query: 637 ELGPWKSRSACKELIRKL*KSMILSALIAPDSTFSVTAFKAASSLRNWKS 488 +L P KSR++ KE+ + +S + +L P T + SS NWKS Sbjct: 317 KLNPQKSRASIKEIEGEHARSNSVVSLDVPQETCNTALVTHGSSPLNWKS 366 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +3 Query: 261 FKSKKYPLVVDEYEPDTFDVLKHRINQRFTNGGNKLVNINLSDSDQLLSYSNVL 422 FKS K P ++DE + D+LK + +F + +N DSD++ + +L Sbjct: 1017 FKSTKNPPLIDELKDFEDDMLKMIQSVKFIEASSPFLNKLKEDSDRIKNKPKLL 1070 >SB_47216| Best HMM Match : Oxidored_molyb (HMM E-Value=0) Length = 672 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/44 (25%), Positives = 26/44 (59%) Frame = -3 Query: 171 HSIRSSLQRKGQEKQKIFLLKDSRKFYWNQRNLTTQDYGGCLVR 40 H+I S++Q G + + +K + W++ ++T ++GG L++ Sbjct: 374 HNIVSTIQCAGNRRSDMNRVKKVKGLDWSEGAISTAEWGGALLK 417 >SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) Length = 1845 Score = 28.3 bits (60), Expect = 7.7 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 4/86 (4%) Frame = +3 Query: 369 VNINLSDSDQLLSYSNVLGDLDIPKVKKQSLQHLKSSVEEDFQFLSELAALKAVTEKVES 548 V + + +LL + + GD ++PK+ +S ++ + E F +E A +T+ + + Sbjct: 1407 VELTTASKSKLLRFIFICGDFNLPKISWESQENTTGAKETAF---AEQLADYFLTQ-LNT 1462 Query: 549 GAISADNIIDFYNL----RINSLHAL 614 I DN++D +IN +H L Sbjct: 1463 IPIRGDNVLDLVIASDPNQINDIHVL 1488 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,096,586 Number of Sequences: 59808 Number of extensions: 392910 Number of successful extensions: 1127 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1070 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1127 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -