BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0030 (800 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6XM74 Cluster: FirrV-1-A13; n=1; Feldmannia irregulari... 34 3.6 UniRef50_Q5A4E5 Cluster: DNA polymerase; n=1; Candida albicans|R... 34 3.6 >UniRef50_Q6XM74 Cluster: FirrV-1-A13; n=1; Feldmannia irregularis virus a|Rep: FirrV-1-A13 - Feldmannia irregularis virus a Length = 163 Score = 34.3 bits (75), Expect = 3.6 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +1 Query: 265 RPVVAWIRQKKTRPVSSPGLSNGPYVGSRSERHLFLLKTE 384 R +V W+ KT P++ +S+G +V + H+F+L+ E Sbjct: 98 RGLVKWLMNSKTHPLTRQPISSGVFVSCMRKLHVFILQNE 137 >UniRef50_Q5A4E5 Cluster: DNA polymerase; n=1; Candida albicans|Rep: DNA polymerase - Candida albicans (Yeast) Length = 1261 Score = 34.3 bits (75), Expect = 3.6 Identities = 16/45 (35%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -2 Query: 427 LSHQSS*TLRNEFKFQFSVKRGVFQTY-YQHTVRLINQVKRRDEF 296 L H + TL+ K+QF ++ GV Q+Y Y+++ + +R DEF Sbjct: 755 LKHDEAYTLKKNTKYQFQIEPGVTQSYDYKYSYNSMKISRRPDEF 799 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 750,000,716 Number of Sequences: 1657284 Number of extensions: 13957349 Number of successful extensions: 27634 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27629 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 68731504465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -