BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0030 (800 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0153 - 12814596-12815645 30 1.9 03_03_0150 + 14872035-14872472,14874895-14875725 29 5.7 >09_03_0153 - 12814596-12815645 Length = 349 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -2 Query: 106 PLLQKAYGLEAVSGSSRRPGSHTRIFRLIAVRLL 5 PLL + YG+ V+ SS TR+F L A++LL Sbjct: 13 PLLVQRYGVAGVTPSSSSSSMATRVFSLPAMKLL 46 >03_03_0150 + 14872035-14872472,14874895-14875725 Length = 422 Score = 28.7 bits (61), Expect = 5.7 Identities = 19/68 (27%), Positives = 30/68 (44%) Frame = -3 Query: 228 GTKIPNL*LYQFRLSSIYSWRLKSHPSYYGIGTDRNLRLGYHYCRKLMGLRQLVVARGGR 49 G +P + ++Q R ++ + P G R+++ G H R L G Q V A GGR Sbjct: 143 GVCLPRICVFQLRQGNLAPGAVSDSPEPEG---GRDVQAGVHEARGLAGGVQEVEAHGGR 199 Query: 48 GRIPVSSD 25 + D Sbjct: 200 VGVGADDD 207 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,360,902 Number of Sequences: 37544 Number of extensions: 392264 Number of successful extensions: 740 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 740 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -