BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0026 (337 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ub... 27 0.77 SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Ma... 24 7.1 SPBC1539.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 23 9.4 SPCC757.10 |vph2||endoplasmic reticulum membrane involved in ass... 23 9.4 >SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ubp21|Schizosaccharomyces pombe|chr 2|||Manual Length = 1129 Score = 27.1 bits (57), Expect = 0.77 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -3 Query: 203 FSNTIIKTIYKIRTSYHTT*VSVVLMIGRVSFYYNLTK 90 F+N KT+YKI T + SV + RV +YNL K Sbjct: 250 FTNIFRKTVYKIPTDNDDSRDSVAYALQRV--FYNLEK 285 >SPCC1223.13 |cbf12||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual Length = 963 Score = 23.8 bits (49), Expect = 7.1 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 114 NTADH*DDTDLRSMIRCSNFVNSFNNSITKLKIAMLIL 227 N ++ + +D RS + CSN V + IT ++ LIL Sbjct: 713 NKGNNSNPSDSRSKVLCSNMVIILVSKITGVQSPPLIL 750 >SPBC1539.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 386 Score = 23.4 bits (48), Expect = 9.4 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 Query: 45 QGLV*TRTRKTAKF*FRQVIVKRNTADH*DDTDLRSMIRCSNFVNS 182 Q LV R KTAK + ++KR H +D+ R SN NS Sbjct: 29 QRLVFGRKHKTAKLEAPRALIKRKQLSHSTSSDI---TRHSNAKNS 71 >SPCC757.10 |vph2||endoplasmic reticulum membrane involved in assembly of the V-ATPase|Schizosaccharomyces pombe|chr 3|||Manual Length = 186 Score = 23.4 bits (48), Expect = 9.4 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 17 ENVPLFVDLSGVSIDKDKENSKVL 88 + +PL ++GVS+D ++E L Sbjct: 56 DGIPLLPSMAGVSMDPEREKKSEL 79 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 932,755 Number of Sequences: 5004 Number of extensions: 12933 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 95984434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -